modE

Molybdenum transport protein ModE

270 amino acids

Involved in the transport of molybdenum into the cell. May have a role in the early intracellular capture or metabolism of molybdenum.

Belongs to the ModE family.

29.035 kDa

MTATRFLARMSLDTDVGTALSDTRIRLLEAIEREGSINRAAKVVPLSYKAAWDAIDTMNNLAPEPLVVRVAGGRQGGGTQLTDYGRRIVAMYRALEIEYQSALDRLSERLNEVTGGDIQAFQRLMHSMSMKTSARNQFAGIVTGLRVGGVDYEVRIRLDAENEIAAVITKASAENLELAIGKEVFALVKSSSVMLTTEPSLKLTARNQLWGEVIDIHEGPVNNEVTLALPSGRSVTCVVTADSCKALGLAPGVAACAFFKSSSVILAVYG

modE

Molybdenum transport protein ModE

269 amino acids

Involved in the transport of molybdenum into the cell. May have a role in the early intracellular capture or metabolism of molybdenum.

Belongs to the ModE family.

28.284 kDa

MSTLPATDTTLLSSELKLVHRLDQRFFALLDAIAQTGSINRAASTAGYSYKGAWMLLESAGNLVNGALIETVTGGKGGGGTRLTPAAVELLAVWRELQRRNLEFLHRQETWLNQLPALAGLLRRMSMKTSARNQFAGVISAIDTGPVTTQVTVTIAGAQEIVATMTTTAANRLKLRIGSNAIALIKSSAVVLVTDFAGFSLSARNQFEGTVSRVERGAVSSLVVLTLPGGACMTASLTNDAIDALSLAVGQTATAVFKAYAVMVAVQQD

modE

Transcriptional regulator ModE

263 amino acids

The ModE-Mo complex acts as a repressor of the modABC operon, involved in the transport of molybdate. Upon binding molybdate, the conformation of the protein changes, promoting dimerization of ModE-Mo. The protein dimer is then competent to bind a DNA region, upstream of the modABC operon. Acts also as an enhancer of the expression of genes coding for molybdoenzymes, both directly and indirectly (By similarity).

Belongs to the ModE family.

28.298 kDa

MQAEILLTLKLQQRLFADPRRIALLKQIQHTGSISQGAKLAGISYKSAWDAINDMNTLSEEILVERATGGKGGGGAHLTRYGERLIQLYDLLATIQQKAFDTLKDDSLPLDSLLAAISRFSLQTSARNQFFGTLIERDHQQVQQHVNILLSDGKTRLTAAITQQSADRLQLSAGKEVLALIKAPWVKLVTDPALAGAADNALPGTVASIEPGNDHSEVIVTLTGGANLCSTQNNSELHALNLRVGSAVIAQFNADRVIIATLC

modE

Transcriptional regulator ModE

262 amino acids

The ModE-Mo complex acts as a repressor of the modABC operon, involved in the transport of molybdate. Upon binding molybdate, the conformation of the protein changes, promoting dimerization of ModE-Mo. The protein dimer is then competent to bind a DNA region, upstream of the modABC operon. Acts also as an enhancer of the expression of genes coding for molybdoenzymes, both directly and indirectly (By similarity).

Belongs to the ModE family.

28.281 kDa

MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLNSLLAAISRFSLQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATLC

modE

DNA-binding transcriptional dual regulator ModE

262 amino acids

Functions as an intracellular molybdate sensor. The ModE-Mo complex acts as a repressor of the modABC operon, which is involved in the transport of molybdate (PubMed:8550508). Binds modA promoter DNA in the absence of molybdate, however molybdate binding confers increased DNA affinity (PubMed:9210473, PubMed:9044285). Binds the promoter of moaA activating its transcription; binding is not enhanced by molybdate (PubMed:9044285). The protein dimer binds the consensus palindrome sequence 5'-TATAT-N7-TAYAT-3' and a variant 5'-TGTGT-N7-TGYGT-3' (PubMed:9210473, PubMed:9044285, PubMed:16205910). Acts as a regulator of the expression of 67 genes, many of which encode molybdoenzymes, acts both directly and indirectly (PubMed:9466267, PubMed:10206709, PubMed:16205910). ModE also binds tungstate (PubMed:9210473, PubMed:11259434).

Belongs to the ModE family.

28.281 kDa

MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLNSLLAAISRFSLQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATLC

modE

Transcriptional regulator ModE

262 amino acids

The ModE-Mo complex acts as a repressor of the modABC operon, involved in the transport of molybdate. Upon binding molybdate, the conformation of the protein changes, promoting dimerization of ModE-Mo. The protein dimer is then competent to bind a DNA region, upstream of the modABC operon. Acts also as an enhancer of the expression of genes coding for molybdoenzymes, both directly and indirectly (By similarity).

Belongs to the ModE family.

28.281 kDa

MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLSDDDALPLNSLLAAISRFSLQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATLC

modE

Transcriptional regulator ModE

255 amino acids

The ModE-Mo complex acts as a repressor of the modABC operon, involved in the transport of molybdate. Upon binding molybdate, the conformation of the protein changes, promoting dimerization of ModE-Mo. The protein dimer is then competent to bind a DNA region, upstream of the modABC operon. Acts also as an enhancer of the expression of genes coding for molybdoenzymes, both directly and indirectly (By similarity).

Belongs to the ModE family.

28.898 kDa

MKNTEILLTIKLQQALFIDPKRVRLLKEIQQCGSINQAAKNAKVSYKSAWDHLEAMNKISPRPLLERNTGGKNGGGTALTTYAERLLQLYDLLERTQEHAFHILQDESVPLDSLLTATARFSLQSSARNQFFGRVAQQRIIDSRCVVDVNVQGLPTPLQVSITTKSSARLKLITEKEVMLMFKAPWVKISEQPLANQPNQFPVNIKSLNEEEAILQFAESNIEFCATVHQPNQWQIEQQVWIHIDQEQIILATLG