mfpA

Pentapeptide repeat protein MfpA

191 amino acids

When present on multicopy plasmids confers increased resistance to fluoroquinolone antibiotics such as ciprofloxacin and sparfloxacin but not the quinolone nalidixic acid (PubMed:11709313). Forms a structure that exhibits size, shape and electrostatic similarity to B-form DNA; it may bind to DNA gyrase which is postulated to protect it from fluoroquinolones (By similarity).

Belongs to the pentapeptide repeat protein family.

21.232 kDa

MRIGANGDETVWADEEFAGRDFRDEDLSRIRTERVVFTECDFSGVDLSESEHHGSAFRNCTFRRSTIWHSTFTNCSLLGSVFTECRIRPVTFVECDFTLAVLGGCDLRAVDLSDCRLREVSLVGADLRKAVLRRADLTGSRVQDARLEEADLRGTRVDPTFWTTAKVRGAKIDIEQALAYAAAHGLAVHGG

mfpA

Pentapeptide repeat protein MfpA

183 amino acids

Might be involved in fluoroquinolone resistance (PubMed:15933203). Inhibits ATP-independent DNA relaxation, ATP-dependent DNA supercoiling and ATP-dependent decatenation by endogenous gyrase, 50% inhibition occurs at 2 uM; inhibition is abolished if GyrA is mutated (Asp-87 to Gly or His) (PubMed:19060136). Also inhibits fluoroquinolone-promoted dsDNA cleavage (PubMed:19060136). Increases fluoroquinolone (ciprofloxacin or moxifloxacin) inhibition of gyrase supercoiling activity in a concentration-dependent manner (PubMed:19060136). Inhibits DNA relaxation and supercoiling by E.coli gyrase (PubMed:15933203). Forms a structure that exhibits size, shape and electrostatic similarity to B-form DNA; it may bind to DNA gyrase which is postulated to protect it from fluoroquinolones (PubMed:15933203).

Belongs to the pentapeptide repeat protein family.

20.02 kDa

MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG