metK

S-adenosylmethionine synthase

430 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.565 kDa

MGYLFTSESVSEGHPDKVADQISDAVLDKLLAYDPSSKVACETLVTTGQVVLAGEVKTKAYVDLQLIAREVIKKIGYTKGEYMFESNSCGVLSAIHEQSPDINRGVERQDPMEQGAGDQGMMFGYATNETENYMPLSLDLAHRILQVLADIRREEKVMTYLRPDAKSQVTIEYDDNGTPVRIDTIVVSTQHDDFIQPADDSAEAQLKADEEMLSIIRRDVIEILMPRVIASIHHDKVLALFNDQIVYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYAARHIAKNMVAAGVADEMLVQVSYAIGVARPINIFVDTYGRSHVNMTDGEIARVIDQLFDLRPKAIEERLKLRNPIYQETAAYGHMGREPQVVSKTFFSRYEGNKTVEVELFTWEKLDYVDKIKAAFGL

metK

S-adenosylmethionine synthase

430 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.596 kDa

MGYLFTSESVSEGHPDKVADQISDAVLDKLLAFDPSSKVACETLVTTGQVVLAGEVKTKAYVDLQRIAREVINRIGYTKSEYMFEGNSCGVFSAIHEQSADINRGVEREDPMNQGAGDQGMMFGYATNETENYMPLSLDLAHKLLMVLAEIRREGKVMTYLRPDAKSQVTIEYDDNGKPVRIDTIVVSTQHDEFVTPADSSKEAQLKADEEMLAKIRQDVIEILMPRVIAGIHNEEVLALFNDRIVYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYAARHIAKNMVAAGVADEMLVQVSYAIGVARPINIYVNTYGRSNVKLSDGEIAKKIDELFDLRPKAIEERLKLRNPIYEETASYGHMGREPKVVTKTYESMYHEAKTLEVELFTWEKLDYVDKIKEAFGL

metK

S-adenosylmethionine synthase

430 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.355 kDa

MGYLFTSESVSEGHPDKVADQISDAVLDKLLAYDPSSKVACETLVTTGQVVLAGEVKTGAYVDLQLIAREVIQKIGYTKGEYMFESNSCGVLSAIHEQSADINRGVEREDPMNQGAGDQGMMFGYATNETENYMPLSLDLAHRILLVLADIRREGKEMTYLRPDAKSQVTIEYDDNGTPVRIDTIVVSTQHDEFILPADNSAAAQLKADEEMLAVIRKDVIEVLMPRVIASINHPKVLALFNDHIIYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYAARHIAKNLVAAGVADEMLVQVSYAIGVARPINIYVNTYGRSNVKMSDGEIARKIDELFDLRPKAIEDRLKLRYPIYSETAAYGHMGREPQMVTKHFQSRYEGDRTMEVELFTWEKLDYVDKVKAAFGL

metK

S-adenosylmethionine synthase

430 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.355 kDa

MGYLFTSESVSEGHPDKVADQISDAVLDKLLAYDPSSKVACETLVTTGQVVLAGEVKTGAYVDLQLIAREVIQKIGYTKGEYMFESNSCGVLSAIHEQSADINRGVEREDPMNQGAGDQGMMFGYATNETENYMPLSLDLAHRILLVLADIRREGKEMTYLRPDAKSQVTIEYDDNGTPVRIDTIVVSTQHDEFILPADNSAAAQLKADEEMLAVIRKDVIEVLMPRVIASINHPKVLALFNDHIIYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYAARHIAKNLVAAGVADEMLVQVSYAIGVARPINIYVNTYGRSNVKMSDGEIARKIDELFDLRPKAIEDRLKLRYPIYSETAAYGHMGREPQMVTKHFQSRYEGDRTMEVELFTWEKLDYVDKVKAAFGL

metK

S-adenosylmethionine synthase

429 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.57 kDa

MSYLFTSESVSEGHPDKVSDQISDAILDQFLATDPDSKVACETLVTTGQVVLAGEVKSRSYVDVQETARRVIEKIGYTKSEYGFDARSCGIFSSIHGQSADINRGVDRSDRSEQGAGDQGMMFGYATNETENYMPLTVDLAHHLLYELATIRKEPSSPMPYLRPDAKSQVTIEHDDEGRPVRIDTIVISTQHDEFVQASDGISEAEADRMMQERIHHDIATILIPRVKMLYKPEIAALFDEKVRLFVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGRASHGGGAFSGKDPSKVDRSAAYAARHIAKNMVAAGVADEMLVQVAYAIGVAEPVSIYVNTKGRSHVALSDGQIAEKIKKIFDMRPYAIEQRLKLRNPIYEETAAYGHFGREPYEAYKTFVDEHGTEQMRIVELFTWEKLDYVNKIKAEFGLS

metK

S-adenosylmethionine synthase

429 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.699 kDa

MSYLFTSESVSEGHPDKVSDQISDAILDQFLATDPDSKVACETLVTTGQVVLAGEVKSRSYVDVQETARRVIERIGYTKSEYGFDTRSCGIFSSIHEQSADINRGVDRSDRSEQGAGDQGMMFGYATNETENYMPLTVDLAHHLLYELAAIRKEPSSPMPYLRPDAKSQVTIEHDDEGRPVRIDTIVISTQHDEFVQASDGISEAEADRMMQERIHHDIATILIPRVKMLYKPEIAALFDEKVRLFVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGRASHGGGAFSGKDPSKVDRSAAYAARHIAKNMVAAGVADEMLVQVAYAIGVAEPVSIYVNTKGRSHVALSDGQIAEKIKKIFDMRPYAIEQRLKLRNPIYEETAAYGHFGREPYEAYKTFVDEHGTEQMRIVELFTWEKLDYVDKIRAEFGLS

metK

S-adenosylmethionine synthase

428 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.345 kDa

MSYLFTSESVSEGHPDKVADQISDALLDEFLAYDKNSKVACETLVTTGQVVLAGEVKSSAYVDVQEVARGVIEKIGYTKSEYQFEAKSCGVFSSIHEQSGDINRGVERADPYEQGAGDQGMMFGYATNETENYMPLALDLSHSLLWELAKIRKEEPDLMPYLRPDAKSQVTIEYDDNGKPLRIDTIVVSTQHDEFIGPKGISQKEADEAMQKRIALDVKKILIPRVKAQYPAHVQALFNDNIIYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYAARHIAKNMVAAGVADEMLVQVSYAIGVAKPMNIFVNTFGRAKVNMTDGEIAAKIWDIFDMRPKAIEERLKLRNPIYFETASYGHMGRKPQTVTKTFSSRYLQKPVTCDVELFTWEKLDYADKIKDVFGL

metK

S-adenosylmethionine synthase

428 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.345 kDa

MSYLFTSESVSEGHPDKVADQISDALLDEFLAYDKNSKVACETLVTTGQVVLAGEVKSSAYVDVQEVARGVIEKIGYTKSEYQFEAKSCGVFSSIHEQSGDINRGVERADPYEQGAGDQGMMFGYATNETENYMPLALDLSHSLLWELAKIRKEEPDLMPYLRPDAKSQVTIEYDDNGKPLRIDTIVVSTQHDEFIGPKGISQKEADEAMQKRIALDVKKILIPRVKAQYPAHVQALFNDNIIYHVNPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYAARHIAKNMVAAGVADEMLVQVSYAIGVAKPMNIFVNTFGRAKVNMTDGEIAAKIWDIFDMRPKAIEERLKLRNPIYFETASYGHMGRKPQTVTKTFSSRYLQKPVTCDVELFTWEKLDYADKIKDVFGL

metK

S-adenosylmethionine synthase

426 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.866 kDa

MRGLKTLSKRYLFTSESVTEGHPDKVCDQISDTILDALLTLDPNSRVAAETVVNTGLTLVTGEITSQAHINFVELIRQKIAEIGYTNADNGYSANSCAVMLAIDEQSPDISQGVTAAQEQRHALSDDELDKIGAGDQGLMFGYACNETPELMPLPISLAHRIALRLSEVRKSGQLAYLRPDGKTQVSILYEDGSPVAIDTILISTQHDEHIGDITDNDAVQAKIKADLWDVVVGHCFSDIALKPTDKTRFIVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQVSYAIGVARPVSVLIDTFGTGKVDEEKLLEVVLANFELRPAGIIQSLNLRNLPAERGGRFYQDVAAYGHFGRNDLDLPWEYTDKVDVLKAAFASSPQAVAV

metK

S-adenosylmethionine synthase

426 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.866 kDa

MRGLKTLSKRYLFTSESVTEGHPDKVCDQISDTILDALLTLDPNSRVAAETVVNTGLTLVTGEITSQAHINFVELIRQKIAEIGYTNADNGYSANSCAVMLAIDEQSPDISQGVTAAQEQRHALSDDELDKIGAGDQGLMFGYACNETPELMPLPISLAHRIALRLSEVRKSGQLAYLRPDGKTQVSILYEDGSPVAIDTILISTQHDEHIGDITDNDAVQAKIKADLWDVVVGHCFSDIALKPTDKTRFIVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQVSYAIGVARPVSVLIDTFGTGKVDEEKLLEVVLANFELRPAGIIQSLNLRNLPAERGGRFYQDVAAYGHFGRNDLDLPWEYTDKVDVLKAAFASSPQAVAV

metK

S-adenosylmethionine synthase

426 amino acids

Catalyzes the formation of S-adenosylmethionine from methionine and ATP. The reaction comprises two steps that are both catalyzed by the same enzyme: formation of S-adenosylmethionine (AdoMet) and triphosphate, and subsequent hydrolysis of the triphosphate.

Belongs to the AdoMet synthase family.

47.92 kDa

MQQNTRYLFASEAVSRGHPDKACDQVSDRVLDYCLQAEKKCKKASRVALETTIKGNVVGLFGEVTCQKTFPTISWFRELVTEIGYSREDLDLDPTTCSVHINVRGQEAEIRGVVHNQERAAKETLGAGDQGLMFGYATDETPERCPCLWFLLRRFKLALRSKFEEARKKKIELAVAKGIKVSQVDATPELRDTIDFWWLHTDAKSQVIIEYEDDSGALKPITARVAVLSVQHSKFVTHDQYEDRLPQLVKGVLDEYGMHSEATEYLINIKQKTSGYGWTVGGPNADAGTTGRKIIVDTYGGHGAHGGGAFSGKDPSKVDRSAAYYARYVAQNLVRAKLCRRVLVQVSYVIGKPEPLNIYVNTYGTGTHSDSELLEIINKNFDFRPGFIIEELDLLNPDRIKYVETAYHGHFGRPEFPWEQEKTLTL

metK

S-adenosylmethionine synthase

424 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.72 kDa

MSRRYLFTSESVTEGHPDKICDQISDTILDALLTQDPSSRVAAEVVVNTGLVLITGEITTKANVNFVNLARKKIAEIGYTNADNGFSANSTSVLLALDEQSPDIAQGVNTAQETRQQDSDELFDKIGAGDQGIMFGFASNETPELMPLPISLAHRIARRLAAVRKTGELSYLRPDGKTQVTVVYEDGRPVGIDTILISTQHTATIGEITDEAAVQAKIKQDLWSAVVEPVFGDIDVKPNDQTRFLVNPTGKFVVGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKVEIQLSYAIGVARPTSILVDTFGTGKVDEETLLELINQHFELRPAGIIHTFNLRNLPSERGGRFYQDVAAYGHFGRADLDLPWEQTDKAELLKQAANESLSAAIAQALT

metK

S-adenosylmethionine synthase

424 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.72 kDa

MSRRYLFTSESVTEGHPDKICDQISDTILDALLTQDPSSRVAAEVVVNTGLVLITGEITTKANVNFVNLARKKIAEIGYTNADNGFSANSTSVLLALDEQSPDIAQGVNTAQETRQQDSDELFDKIGAGDQGIMFGFASNETPELMPLPISLAHRIARRLAAVRKTGELSYLRPDGKTQVTVVYEDGRPVGIDTILISTQHTATIGEITDEAAVQAKIKQDLWSAVVEPVFGDIDVKPNDQTRFLVNPTGKFVVGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKVEIQLSYAIGVARPTSILVDTFGTGKVDEETLLELINQHFELRPAGIIHTFNLRNLPSERGGRFYQDVAAYGHFGRADLDLPWEQTDKAELLKQAANESLSAAIAQALT

metK

S-adenosylmethionine synthase

424 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

47.51 kDa

MSYLFTSESVSEGHPDKVADQISDAILDYFIAYDTNSKVACETLVTSGQIILAGEVKSKVYLDIPEIVREVIEGIGYTKSEYHFESKSSGIISLIHEQSNDISRGIERESPLDQGAGDQGMMFGYATNETANYIPLSLDLSHQLMKELTNIRKYEPELMPYLRPDAKSQVTIRYHDNDIPKSIDTIVISTQHDEFDTAEVMQSKIMKDVRNILIPRIKANYSENIQALFDDKIKYYINPTGKFVIGGPHGDAGLTGRKIIVDTYGGRGAHGGGAFSGKDPSKVDRSAAYAARHIAKNLVAAGVSEEVLVQVSYAIGVTKPINIFVNTYGKSKVKLTDSQIAERVLEIFDLRPKAIENRLKLRNPIYKETAAYGHMGRLPKIVKKVFTPRYANVAKSKDLKKELKVELFTWEKLDYVKKIRKIFQ

metK

S-adenosylmethionine synthase

422 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.876 kDa

MRRYQFTSESVTEGHPDKVCDQISDAILDGILEKDPTARVACETLVKTGMAVVAGEITTSAWVDMPVVVRNTIKDIGYTDAAMGFDYETCAVLTAIEKQSPDISRGVTEGEGLFKEQGAGDQGLMFGYATDETSELMPSPISYAHRLARKLADLRKSKKLDWLRPDGKTQVTIEYEDQTPVRVSAVVVSTQHSPEVKHKTIVDAVRSLIIEKCIPAKLMDKSTKIYVNPTGRFVVGGPFGDAGLTGRKIIVDTYGGMGRHGGGAFSGKDPTKVDRSACYYARYVAKNVVASKLAARCEVQIAYAIGVAQPVGVHVNTFGTGRVGEDVLEKYIMQNFDMRPKAIIEQLDLLKPIYRKTAAYGHFGRDEFTWEKTDRAAKLAEDLLRPTLAAVPATTNGAGSKNGSGSKKEPKRKGKKETGAQA

metK

S-adenosylmethionine synthase

422 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.902 kDa

MSRRYLFSSESVTEGHPDKICDQISDTILDALLYHDDHSRVAAEVVVNTGLVLITGEITSKAHVNFVELARKKIAEIGYTDADNGFSANSCAVLVAIDEQSPDISQGVSAAHEQRESLSNDELDQIGAGDQGIMFGYACNETPEFMPLPISLAHRISRRLAAVRKMGELPYLRPDGKTQVSIVYEDGKPVGIDTILISTQHTETIDSLTENSAVQAKIKSDLWEAVVQPVFGDIEIKPNQDTRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLADKCEVQVSYAIGVARPVSILVETFGTGKVDEDKLLKVVQELFELRPAGILQTLNLRELPSQRGGRFYQDVAAYGHFGRTDLDLPWEYTDKANLLKEAFAIPLSEVRVGV

metK

S-adenosylmethionine synthase

421 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.696 kDa

MTQRYLFTSESVTEGHPDKICDQISDTILDALLSQDPQSRVAAEVVVNTGLVLITGEITSQAQVNYVDLVRKKITEIGYTSAENGFCATSCAVLVALDEQSPDIAQGVNVAQESRQQLSDEALDRIGAGDQGIMFGFACNETPEFMPLPISLAHRMARKLAAVRKTHQLPYLRPDGKTQVTVIYEDGRPVGIDTILISTQHTPTIGEISDEAEVQAKIKQDLWTMVVQPVFSDLTVKPDQNTRFLVNPTGKFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKCEVQLSYAIGVARPVSIFVDTFGTGKIADERLLELVQQHFELRPAGMIQSFGLRHLPSDRGGRFYQDVAAYGHFGRPDLELPWEQTDKAALLQEALPKTLSGAVSV

metK

S-adenosylmethionine synthase

420 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.38 kDa

MSRRYLFTSESVTEGHPDKICDQISDTILDTLLTQDPTSRVAAEVVVNTGLVLITGEITTKANVNYANIARQKIAEIGYTNADNGFSASSTSVIVALDEQSPDIAQGVNTAQETREQDSEELFDKIGAGDQGIMFGFACNETPELMPLPICLAHRIARRLAAVRKTGELSYLRPDGKTQVTVVYEDGRPVGIDTVLISTQHTATIGDITDEAAVQAKIKQDLWTAVVEPVFGDLEIKPDQETRFLVNPTGKFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAEKCEVQLSYAIGVARPVSIFLDTFGTGKVDDEILLGLVKDNFELRPAGIIHSFNLRNLPSERGGRFYQDVAAYGHLGRNDLDLPWERTDKADFLKQAVTHSLSAAIA

metK

S-adenosylmethionine synthase

420 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.818 kDa

MSSRYLFTSESVTEGHPDKICDQISDTIIDAILAQDPQSRVAAEVVVNTGLVLITGEITTKAQVNYIELARKKIADIGYVHAENGFSADSCSVLVALDEQSADIAQGVDKAQETRELLSEEELDAVGAGDQGLMFGFACNETPELMPLPISLAHRVCRQLTAVRKTGQLPYLRPDGKSQVTITYEDGRPVGIDTILISTQHTAKIGEITELSDIQAKIKEDLWKYVVEPIFKDAEIKPNSQTRFLVNPTGKFVIGGPQGDCGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYIAKNIVAADLAEKCEVQISYAIGVAKPVSMMIETFGTSKVDEDKLLEVVKENFELRPAGIIQNFNLRNLPGERGGRFYQDVAAYGHLGRTDLDLPWEQTDKVELLKQAFSPQLLATAS

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.373 kDa

MSRYLFSSESVTEGHPDKICDQISDTILDALLTQDPRSRVAAEVVVNTGMVVVTGEITTTANVNFTKLVRDKIREIGYTEADNGFSADSCAVFLALDEQSPEIAQGVSCALEVRTSEEDALDRIGAGDQGLMFGFACTETPELMPLPISVAHRLTRRLAQVRKDGTLAYLKPDGKAQVTVEYERKDGVDRPGRIDTILISTQHAAVIDDLSDNDAVQARIKADLQTHVIGPVFADLDIRPDAQTRLLVNPSGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAELADRCEVQVAYAIGVARPVSIFVETFGTGRVSDEALMLLVREHFDLRPAAILRDFDLCRLPAQRGGRFYQDVAAYGHLGRPDLDLPWEHTDKAATLKQAIQTAAAV

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.072 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRDVIREIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVDEADDHEGDPLDKVGAGDQGIMFGYACNETPELMPLPISLAHRLSRRLAEVRHNGTLDYLLPDGKTQVSVVYENDKPVAIDTILISTQHTAEVAGLSDEQQVRERISDDLWTHVVEPATADLPLKPSKDSTRYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKCLVAAGLAQRAEVQLSYAIGVAKPVSILVESFGTGKVSNAELTELVQQHFDLRPGAIIQQFKLREMPALSGGRFYRDTAAYGHFGRPDLKLPWEDVENKASTLLQAEASRLQQGNTL

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.911 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVDEADDHEGDPLDRVGAGDQGIMFGYACNETPELMPLPISLAHRLAKRLAEVRHNGSLEYLLPDGKTQVSVVYENDKPVAIDTILISTQHTAEVAGISDEQGIRERITEDLWTHVVEPATADLALKPSREATKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKCLVASGLAERAEVQLSYAIGVAKPVSILVESFGTGKVSNAELTELVQEHFDLRPGAIIETFGLRNLPQQRGGRFYQDTAAYGHFGRNDLKAPWEDVAAKSEELVKAEAKRIKQGATV

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.927 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSTSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRDVIRDIGYSGARAGGFDATSCAVLVALDQQSPDIAQGVDEADDHAGDPLDKVGAGDQGIMFGYACNETPELMPLPISLAHRLARRLAEVRHNGTLDYLLPDGKTQVSVVYENDKPVEIDTILISTQHTAEVTGLTDEQEVRNRISEDLWTHVVLPATADLPLKPDRANCRYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKALVAAGLANRAEVQLSYAIGVAKPVSILVESFGSGKVSNAELTDLVQEHFDLRPGAIIEQFKLREMPSLNGGRFYRDTAAYGHFGRPDLNLPWEDVGDKAASLKQAEANRIQSGSSL

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.373 kDa

MSRYLFSSESVTEGHPDKICDQISDTILDALLTQDPRSRVAAEVVVNTGMVVVTGEITTTANVNFTKLVRDKIREIGYTEADNGFSADSCAVFLALDEQSPEIAQGVSCALEVRTSEEDALDRIGAGDQGLMFGFACTETPELMPLPISVAHRLTRRLAQVRKDGTLAYLKPDGKAQVTVEYERKDGVDRPGRIDTILISTQHAAVIDDLSDNDAVQARIKADLQTHVIGPVFADLDIRPDAQTRLLVNPSGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAELADRCEVQVAYAIGVARPVSIFVETFGTGRVSDEALMLLVREHFDLRPAAILRDFDLCRLPAQRGGRFYQDVAAYGHLGRPDLDLPWEHTDKAATLKQAIQTAAAV

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.072 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRDVIREIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVDEADDHEGDPLDKVGAGDQGIMFGYACNETPELMPLPISLAHRLSRRLAEVRHNGTLDYLLPDGKTQVSVVYENDKPVAIDTILISTQHTAEVAGLSDEQQVRERISDDLWTHVVEPATADLPLKPSKDSTRYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKCLVAAGLAQRAEVQLSYAIGVAKPVSILVESFGTGKVSNAELTELVQQHFDLRPGAIIQQFKLREMPALSGGRFYRDTAAYGHFGRPDLKLPWEDVENKASTLLQAEASRLQQGNTL

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.911 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVDEADDHEGDPLDRVGAGDQGIMFGYACNETPELMPLPISLAHRLAKRLAEVRHNGSLEYLLPDGKTQVSVVYENDKPVAIDTILISTQHTAEVAGISDEQGIRERITEDLWTHVVEPATADLALKPSREATKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKCLVASGLAERAEVQLSYAIGVAKPVSILVESFGTGKVSNAELTELVQEHFDLRPGAIIETFGLRNLPQQRGGRFYQDTAAYGHFGRNDLKAPWEDVAAKSEELVKAEAKRIKQGATV

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.927 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDSTSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRDVIRDIGYSGARAGGFDATSCAVLVALDQQSPDIAQGVDEADDHAGDPLDKVGAGDQGIMFGYACNETPELMPLPISLAHRLARRLAEVRHNGTLDYLLPDGKTQVSVVYENDKPVEIDTILISTQHTAEVTGLTDEQEVRNRISEDLWTHVVLPATADLPLKPDRANCRYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKALVAAGLANRAEVQLSYAIGVAKPVSILVESFGSGKVSNAELTDLVQEHFDLRPGAIIEQFKLREMPSLNGGRFYRDTAAYGHFGRPDLNLPWEDVGDKAASLKQAEANRIQSGSSL

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.971 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCLITGEVTSNAQVDFIHLVRNVIREIGYSGARAGGFDATSCAVLVALDQQSPDIAQGVNEADDHSGDPLDKVGAGDQGIMFGYACDETPELMPLPISLAHRLARQLAAVRHDGSLSYLLPDGKTQVSVVYENDRPVAIDTILISTQHTSEVEGISDENGIRERITQDLWTHVVEPATADLPLKPNREATRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKCLVAAGLAQRAEVQLSYAIGVAKPVSILVESFGTGKVTNDELTALVQDHFDLRPGAIIEQFKLRQLPQQRGGRFYQDTAAYGHFGRPDLKLPWEDVTDKASTLLQAEAQQQKQGSSL

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.959 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCLITGEVTSNSQVDFIHLVRNVIREIGYSGARAGGFDATSCAVLVALDQQSPDIAQGVNEADDHSGDPLDKVGAGDQGIMFGYACDDTPELMPLPISLAHRLARQLAAVRHDGSLSYLLPDGKTQVSVVYENDRPVAIDTILISTQHTSEVEGISDENGIRERITQDLWTHVVEPATADLPLKPNREATRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKCLVAAGLAQRAEVQLSYAIGVAKPVSILVESFGTGKVTNDELTALVQDHFDLRPGAIIEQFKLRQLPQQRGGRFYQDTAAYGHFGRPDLNLPWEDVTDKASTLLQAEAQQQKQGSSL

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

46.7 kDa

MPYLFTSESVSEGHPDKVADQISDALIDHFLAFDPNAKVACETLVTTGQVVLAGEVKSKAYLDVQEIAREVIRKIGYTKSEYMFEANSCGIFSAIHEQSADINQGVDRKKKEEQGAGDQGMMFGYATNETNDYMPLALDLAHKLLIELAALRREGKQIKYLRPDAKSQVTLEYDDNNRPVRIDAIVLSTQHDDFDTEEKMHKKIEKDIVSILIPRIVSKYPKYKKFFDGKTKIKYHINPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYATRHIAKNLVAAGLCDEVLVQVSYAIGVAKPMGIYVNTYGTAKVKKNDGEIAKIVEKLFDMRPYAIEQRLQLRNPIYSETAAYGHMGRKPETVTKSFKSNDGKIIKKKVELFTWEKLDYVDKVRKAFGIK

metK

S-adenosylmethionine synthase

419 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

46.511 kDa

MAYLFTSESVSEGHPDKIADQISDALLDNFLAFDGESKVACETMVTTGQVVLAGEVRSNTYLDVQNIARDVINDIGYTKGAYKFSGDSCGVISLIHEQSQDIYQGVDRGNKEEQGAGDQGMMFGYATNETENYMPLALDISHKILIELAKLRREGKEIEYLRPDSKSQVTIEYSDENVPERIVAIVVSTQHDDFDADDEKMLTKIKKDIIEILIPRVKKQLPEYVQKLFNDDIVYHINPTGKFVIGGPHGDAGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYASRHIAKNLVAAGVAPEILVQVSYAIGVVEPTSISVYTYGKNNTDLSDGQIAEKVKEIFDMRPSSIEDRLKLRNPIYRETAAYGHMGKEPRKVTKIFESPYKGKITREVELFTWEKLDYVDKVKDAFELN

metK

S-adenosylmethionine synthase

418 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.887 kDa

MPKRYLFTSESVTEGHPDKVCDQISDTILDALLSQDPASRVAAEVVVNTGLVLLTGEITTKAQVNFVDLVRQKITEIGYTDSDNGFAANSCSVLVALDEQSPDIAQGVDSAQETREEKSDQELDAIGAGDQGLMFGFACNETPELMPLPISLAHRVTRRLAAVRKTQLGYLRPDGKSQVTVTYEDGRPVGIDTILVSTQHDATIGDITDPAAVQAKIKEDLWNAVVLPVFADIDIKPDDNTRFLVNPTGQFVVGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSILIETFGTGKVDEDRLLQVVQENFELRPAGLIQTFGLTKLPGERGGRFYQDVAAYGHFGRTDLDLPWEATDKADLLKQALSPALSGNA

metK

S-adenosylmethionine synthase

418 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.455 kDa

MTRRYLFTSESVTEGHPDKICDQISDTILDALLSQDPYSRVAAEVVVNTGLVLITGEITSKAQVNYVDLARQKIAEIGYTDSNNGFSANSCAVLVALDEQSPDISQGVTKAQERREQLSDDELDHIGAGDQGLMFGFACNETPELMPMPISLAHRIARRLAAVRKTGELPYLRPDGKTQVSVIYEDGKPVGIDTILISTQHTETLGQITDNAAIQKTIKDALWQAVVTPSFGDIEIKPDNNTKFLVNPTGKFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRHVAKNIVAAGLADKCEVQVSYAIGVARPVSIMIETFGTGKVSEEKLLEFVKEHFELRPAGIIQAYNLRHIPQERGRFYQDVAAYGHFGRTDLDLPWEKTDKVALLKDAFSQPAIVAG

metK

S-adenosylmethionine synthase

417 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.189 kDa

MTRRYLFTSESVTEGHPDKICDQISDTILDALLTEDPSSRVAAEVVVNTGLVLITGEVSTQAQTNLIDLARRKIAEIGYTGEDSGFGANNCTVLIALDKQSPDIAQGVDTAQEQRQASSDERFDSIGAGDQGIMFGYACNEAPELMPLPISLSHRLARQLAVVRHNGQLDYLRPDGKTQVTIAYEDGKPVAIDTILISTQHKAAIGDISDDNAVQERIKSDLWEQVVLPVFSDLVIQPDSATRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVLVETFGTGKVADEVLLDLVRKHFELRPAGIIEHFNLQRLPGERGGRFYQEVAAYGHFGRNDLDLPWEQTDKADTLRQEALATTQA

metK

S-adenosylmethionine synthase

417 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.041 kDa

MSRRYLFTSESVTEGHPDKICDQISDAILDAVLAADPSSRVAAEVVTNTGLVLITGELTTQANVNFIQVARQKIKEIGYTNADNGFSANSCSVMVALDEQSPDIAQGVTSAQEQRDKLSDDQLDEIGAGDQGLMFGYACNETPEFMPLPISLAHRLSLKLSQVRKSGELPYLGPDGKTQVTVIYEDGKPVGIDTILISTQHTETIGALTDNTEIQAKIKADLLEKVIKPVFVGATVGLSDSTKFLVNPTGKFVIGGPQGDSGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSASYACRYVAKNIVAAGLAEKCEVQVSYAIGVARPVSVMIETFGTCTVDEDRLLEVVQKHFELRPAGIIQAFDLRNLPSQRNGRFYQDMAAYGHFGRTDLDLPWERLDKVDILKQELATATVA

metK

S-adenosylmethionine synthase

417 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.189 kDa

MTRRYLFTSESVTEGHPDKICDQISDTILDALLTEDPSSRVAAEVVVNTGLVLITGEVSTQAQTNLIDLARRKIAEIGYTGEDSGFGANNCTVLIALDKQSPDIAQGVDTAQEQRQASSDERFDSIGAGDQGIMFGYACNEAPELMPLPISLSHRLARQLAVVRHNGQLDYLRPDGKTQVTIAYEDGKPVAIDTILISTQHKAAIGDISDDNAVQERIKSDLWEQVVLPVFSDLVIQPDSATRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVLVETFGTGKVADEVLLDLVRKHFELRPAGIIEHFNLQRLPGERGGRFYQEVAAYGHFGRNDLDLPWEQTDKADTLRQEALATTQA

metK

S-adenosylmethionine synthase

417 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.041 kDa

MSRRYLFTSESVTEGHPDKICDQISDAILDAVLAADPSSRVAAEVVTNTGLVLITGELTTQANVNFIQVARQKIKEIGYTNADNGFSANSCSVMVALDEQSPDIAQGVTSAQEQRDKLSDDQLDEIGAGDQGLMFGYACNETPEFMPLPISLAHRLSLKLSQVRKSGELPYLGPDGKTQVTVIYEDGKPVGIDTILISTQHTETIGALTDNTEIQAKIKADLLEKVIKPVFVGATVGLSDSTKFLVNPTGKFVIGGPQGDSGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSASYACRYVAKNIVAAGLAEKCEVQVSYAIGVARPVSVMIETFGTCTVDEDRLLEVVQKHFELRPAGIIQAFDLRNLPSQRNGRFYQDMAAYGHFGRTDLDLPWERLDKVDILKQELATATVA

metK

S-adenosylmethionine synthase

416 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.096 kDa

MSKRYLFTSESVTEGHPDKICDQISDTILDALLSQDDHSRVAAEVVVNTGLVLITGEITSKAQVHFVDLVRKKIAEIGYINADNGFSSNSCTVLVALDEQSPDISQGVTAAQENRELLSNDELDKIGAGDQGIVFGFACNETPEFMPLPISLAHRIARRLAAVRKTGELSYLRPDGKTQVSVIYEDGRPVGIDTILVSTQHDATIGDITDNDLVQQKIKSDLWEAVVQPVFSDLEIKPDANTRYLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLADKCEIQVGYAIGVARPVSLFVETFGTGKVADDVILDLINKYFELRPAGIIQTFNLRGLPSERGERFYQDVAAYGHFGRNDLDLPWEQTDKAAILKEALTSAVV

metK

S-adenosylmethionine synthase

416 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.658 kDa

MAYLFTSESVSEGHPDKVADQISDALIDNFLAFDAQSKVACETLVTTGQVILAGEVKSNTYLDVQNIAREVIRKIGYTKSEYMFEANSCGILSAIHEQSADINQGVDRASKEEQGAGDQGMMFGYATNETENYMPLALDLSHALLIELANLRRENNDIKYLRPDAKSQVTLEYSDDNKPQRIDAIVISTQHDDFDEEATMLAKIKTDLVSILIPRIKAKYPQYAHLFNDQITYHINPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYATRHIAKNLVAAGICDEILVQVSYAIGVAKPTSINVVTYGTSKVNLTDGEISKKVEAIFDMRPYFIEQRLKLRNPIYSETAAYGHMGRTPETVTKTFSAPGGLTKTVEVELFTWEKLDFVDTVKTAFGI

metK

S-adenosylmethionine synthase

416 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.658 kDa

MAYLFTSESVSEGHPDKVADQISDALIDNFLAFDAQSKVACETLVTTGQVILAGEVKSNTYLDVQNIAREVIRKIGYTKSEYMFEANSCGILSAIHEQSADINQGVDRASKEEQGAGDQGMMFGYATNETENYMPLALDLSHALLIELANLRRENNDIKYLRPDAKSQVTLEYSDDNKPQRIDAIVISTQHDDFDEEATMLAKIKTDLVSILIPRIKAKYPQYAHLFNDQITYHINPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYATRHIAKNLVAAGICDEILVQVSYAIGVAKPTSINVVTYGTSKVNLTDGEISKKVEAIFDMRPYFIEQRLKLRNPIYSETAAYGHMGRTPETVTKTFSAPGGLTKTVEVELFTWEKLDFVDTVKTAFGI

metK

S-adenosylmethionine synthase

416 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.731 kDa

MAYLFTSESVSEGHPDKVADQISDALIDNFLAFDADSKVACETLVTTGQVILAGEVKSNTYLDVQQIAREVIRKIGYTKSEYMFEANSCGILSAIHEQSADINQGVDRAKPEEQGAGDQGMMFGYATNETENFMPLALDLSHKLLQELAILRRENKEITYLRPDAKSQVTLEYSDDNKPTRIDAIVISTQHDDFDEEAAMLAKIKKDVIEILIPRIIAKNPEHAHLFNDKINYHINPTGKFVIGGPHGDTGLTGRKIIVDTYGGKGAHGGGAFSGKDPSKVDRSAAYATRHIAKNLVAAGVADEILVQVSYAIGVAEPMGIFIETYGTSKVNLTNGEIAKKVEAIFDMRPYFIEQRLKLRNPIYSETAAYGHMGRKPETVTKTFSAPGGNEKTVTVELFTWEKLDFVDQVKTAFGL

metK

S-adenosylmethionine synthase

416 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.936 kDa

MSRRYLFTSESVTEGHPDKICDQISDTIIDTLLYHDDQSRVAAEVVVNTGLVLITGEVTSKANVNFVELARKKIAEIGYTNADNGFSANSCAVLVALDEQSPDIAQGVTQAHEQRQALSDDELDQIGAGDQGIMFGYACNETPELMPLPISLAHRFSRRLAAVRKTGDLGYLRPDGKTQVSIVYEDGIPVGIDTILISTQHDETIDSITDNDGVQAKIKSDLWDAVVLPVLDNIGIKPSQETRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSILVETFGTGKVDENKLLDAVKELFELRPAGIIQALNLRQLPSQRGGRFYQDVAAYGHFGRNDLDLPWEATDKAALLKEALLKVGV

metK

S-adenosylmethionine synthase

416 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.083 kDa

MRYLFSSESVTEGHPDKICDQIADAILDALLTQDPQSRVAAEVVVNTGLVLITGEITTKAQVNYVNLARQKIHEIGYTDANNGFAANSCAVLVALDEQSPDIARGVDTAQEAREQLSDAELDRIGAGDQGIMFGYACNETPEYMPLPISLAHRMARRLAAVRKTGQLPYLRPDGKTQVTVIYEDGKPVGIDTILISTQHTATIDDISEESAVQAKIKADLWEAVVKPVFADLTLQPDGNTRFLVNPTGKFVIGGPQGDSGLTGRKLVVDTYGGYARHGGGAFSGKDPTKVDRSAAYMARYIAKNIVAAGLADKCELQISYAIGVARPMSLFVDTFGTGKLSPEQLLELIKTHFDLRPAAIIQTLNLRHLPQERGGRFYQDVAAYGHFGRHDLDLPWEKLDKVADLQAAAAQFLSAV

metK

S-adenosylmethionine synthase

414 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.707 kDa

MFSSESVTEGHPDKICDQISDAIVDALLTADPLSRVAAEVVVNTGMVILTGEITSQAHVNFTRLVRDKVAEIGYTDAKNGFSAESCAVLVAFDEQSPDIAQGVNLALESRTSQEDEFDLIGAGDQGLMFGFACDETPELMPLPISLAHRLSRQLAAVRKNGTLPYLRPDGKTQVTVAYEEGRPVGIHTLLISTQHTPTIGAITEEAAVQERIRADLWEAVVQPVFAELPIKPDGNTRFLTNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAQKCEVQVSYAIGVARPINLLVETFGTGRIPDEALLRLVQRHFDLRPAAILAQFQLRELPRQRGGRFYQNVAVYGHFGQTHLDLPWERTDKAALLREEAFAGATAILG

metK

S-adenosylmethionine synthase

414 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.82 kDa

MFSSESVTEGHPDKICDQISDAIVDALLTADPLSRVAAEVVVNTGLVLLTGEITSQAQVNFTRLVRDKVAEIGYTDAKNGFCAESCAVLVAFDEQSPDIAQGVNMALESRGSQEDQFDLVGAGDQGLMFGFACDETPELMPLPISLAHRLSRQLATVRKNGTLPYLRPDGKTQVTVAYEEGRPVGIHTLLISTQHTPTIGAITEEAAVQERIRADLWEAVVTPVFAELPIKPDSHTRFLTNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAQKCEVQVSYAIGVARPINILVETFGTGRIPDEELLRLVQRHFDLRPAAILAQFQLRELPRQRGGRFYQNVAVYGHFGQTHLDLPWERTDKAALLREEALAKATALLA

metK

S-adenosylmethionine synthase

414 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.707 kDa

MFSSESVTEGHPDKICDQISDAIVDALLTADPLSRVAAEVVVNTGMVILTGEITSQAHVNFTRLVRDKVAEIGYTDAKNGFSAESCAVLVAFDEQSPDIAQGVNLALESRTSQEDEFDLIGAGDQGLMFGFACDETPELMPLPISLAHRLSRQLAAVRKNGTLPYLRPDGKTQVTVAYEEGRPVGIHTLLISTQHTPTIGAITEEAAVQERIRADLWEAVVQPVFAELPIKPDGNTRFLTNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAQKCEVQVSYAIGVARPINLLVETFGTGRIPDEALLRLVQRHFDLRPAAILAQFQLRELPRQRGGRFYQNVAVYGHFGQTHLDLPWERTDKAALLREEAFAGATAILG

metK

S-adenosylmethionine synthase

414 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.82 kDa

MFSSESVTEGHPDKICDQISDAIVDALLTADPLSRVAAEVVVNTGLVLLTGEITSQAQVNFTRLVRDKVAEIGYTDAKNGFCAESCAVLVAFDEQSPDIAQGVNMALESRGSQEDQFDLVGAGDQGLMFGFACDETPELMPLPISLAHRLSRQLATVRKNGTLPYLRPDGKTQVTVAYEEGRPVGIHTLLISTQHTPTIGAITEEAAVQERIRADLWEAVVTPVFAELPIKPDSHTRFLTNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLAQKCEVQVSYAIGVARPINILVETFGTGRIPDEELLRLVQRHFDLRPAAILAQFQLRELPRQRGGRFYQNVAVYGHFGQTHLDLPWERTDKAALLREEALAKATALLA

metK

S-adenosylmethionine synthase

413 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.141 kDa

MSDFIFTSESVTEGHPDKICDQISDAVLDALLKEDPESRVACETVVNTGLCLLTGEITSRAKLDYIKLVRKVIKEIGYEGAKAGGFDSNSCAVLVALDEQSPDISQGVNEADDLNEDLENNTGAGDQGIMFGYACDETPELMPLPISLAHRLARQLAKVRHENVLEYLLPDGKTQVSIDYKKGVPVSINTILISTQHRAEIDGIINEKEIRQKITDDLWINVVLPVTEDLEIKPSKEKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVDTFGTSVISQDNLKELIENNFDLRPAAIIKEFDLRNLPKKLGGEFYRKTASYGHFGRNDLNLPWESVEVKAAQLVEASKDFL

metK

S-adenosylmethionine synthase

413 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.27 kDa

MSDFIFTSESVTEGHPDKICDQISDAVLDALLTEDPESRVACETVVNTGLCLLTGEITSKAKVDYIKLVRNVIKEIGYEGYRAGGFDANSCAVLVALDEQSPDISQGVNYADDVNDDLEDNTGAGDQGIMFGYACDETPELMPLPISLAHRLAIQLAKVRHEEVLNYLLPDGKTQVSIDYEKGLPVSINTILISTQHNPEIDGITNEEEIRQRIKEDLWTHVVIPATEDLKIKPNISKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVETFDTGVISQANLTELIKEHFDLRPAAIIKEFNLRNLPKKMGGNFFRKTASYGHFGRRDLQLPWENVEEKAAKLEEASKIFL

metK

S-adenosylmethionine synthase

413 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.083 kDa

MSDFIFTSESVTEGHPDKICDQISDAVLDALLSEDPESRVACETVVNTGLCLLTGEITSRAKLDYIKLVRKVIKEIGYEGSKAGGFDSNSCAVLVALDEQSPDISQGVNEADDINEDLENNTGAGDQGIMFGYACDETPELMPLPISLAHRLAIQLAKVRHEKVLDYLLPDGKTQVSIDYKKGVPVSINTILISTQHTAEIDGITNEEEIRQKIKEDLWINVVLPATEDLEIKPSNQKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVETFGTGIISQDNLKELIKNNFDLRPAAIIKEFDLRNLPKKMGGEFFRKTASYGHFGRNDLNLPWERVEEKSAQLVEASKILL

metK

S-adenosylmethionine synthase

413 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.201 kDa

MSDFIFTSESVTEGHPDKICDQISDAVLDALLTEDPESRVACETVVNTGLCLLTGEITSKAKVDYIKLVRNVIKEIGYEGYRAGGFDANSCAVLVALDEQSPDISQGVNEADDVNDDLEDNTGAGDQGIMFGYACDETPELMPLPISLAHRLAIQLSKVRHENMLNYLLPDGKTQVSIDYKNGVPLSINTILISTQHNPEIDGITNEEEIRQRIKEDLWKNVVLPATEDLEIKPNIQTTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVETFDTGVISQANLTELINKYFDLRPAAIIKEFDLRNLPQKMGGTFFRKTASYGHFGRRDLDLPWEKVEEKAAQLAEASKVFL

metK

S-adenosylmethionine synthase

413 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.217 kDa

MSDFIFTSESVTEGHPDKICDQISDAVLDALLTEDPESRVACETVVNTGLCLLTGEITSKAKVDYIKLVRNVIKEIGYEGYRAGGFDANSCAVLVALDEQSPDISQGVNDADDINDDLEDNTGAGDQGIMFGYACDETPELMPLPISLAHRLAIQLAKVRHEEVLNYLLPDGKTQVSIDYEKGLPVSINTILISTQHNSEIDGVTNEEEIRQRIKEDLWKNVVIPATEDLEIKPNISKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVETFDTGVISQNNLTELIKEHFDLRPAAIIKEFNLRNLPKKMGGKFFRKTASYGHFGRRDLELPWENVEEKAAKLAEASKIFL

metK

S-adenosylmethionine synthase

413 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

45.217 kDa

MSDFIFTSESVTEGHPDKICDQISDAVLDALLTEDPESRVACETVVNTGLCLLTGEITSKAKVDYIKLVRNVIKEIGYEGYKAGGFDANSCAVLVALDEQSPDISQGVNEADDVNDDLEDNTGAGDQGIMFGYACDETPELMPLPISLAHRLAIQLAKVRHENLLNYLLPDGKTQVSIDYEKGLPVSINTILISTQHNPEIDGLTNEEEIRQRIKEDLWKHVVIPATEDLEIKPNIIKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKSIVKAKLAKKAEVQLSYAIGVAKPISILVDTFDTGVISQANLTELIKKYFDLRPAAIIKEFDLRNLPQKMGGKFFRKTASYGHFGRRDLDLPWEKVEEKAAQLAEASKVFL

metK

S-adenosylmethionine synthase

411 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.787 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVNEADDHAGDPLDLVGAGDQGIMFGYACNETPELMPLPISLAHRLSRRLAEVRHNGTLGYLLPDGKTQVSVVYENDKPVSIDTILISTQHTAEVDGISDEQGIRERITEDLWTHVVEPATADLALKPSREATKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKCLVAAGLAERAEVQLSYAIGVAKPVSILVESFGTSALANDALTALVQEHFDLRPGAIIETFGLRNLPQQRGGCFYQDTAAYGHFGRNDLNAPWEDVTAKSQELKQVAAA

metK

S-adenosylmethionine synthase

411 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.787 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPSSRVACETVVNTGLCMITGEVTSKAQVDFIHLVRNVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVNEADDHAGDPLDLVGAGDQGIMFGYACNETPELMPLPISLAHRLSRRLAEVRHNGTLGYLLPDGKTQVSVVYENDKPVSIDTILISTQHTAEVDGISDEQGIRERITEDLWTHVVEPATADLALKPSREATKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKCLVAAGLAERAEVQLSYAIGVAKPVSILVESFGTSALANDALTALVQEHFDLRPGAIIETFGLRNLPQQRGGCFYQDTAAYGHFGRNDLNAPWEDVTAKSQELKQVAAA

metK

S-adenosylmethionine synthase

411 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.18 kDa

MSLRLFSSESVTEGHPDKICDAISDKILDALIAKDPEARVAVETVVTTGLVHVVGEIRTTTYVEIPALVRKTLLEIGFNSSDMGFDGSTCGVSVAIGEQSQEIAQGVDTALEHRSHDAEGGAELDEIDRLGAGDQGLMFGYATNETPEYMPLPIALAHRLSRRLTEVRKKGIVPHLRPDGKTQVTFAYDAEGAPVRLDTVVVSTQHDAGIEQEWLHEQIRTHVVQHVLDEAGLSGNLADTDYTLLVNPSGSFVLGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSGAYAMRWVAKNIVAAGLADRAEVQVAYAIGRATPVGLYVETFGTEKAPVEAIQAAVRQVFDLRPAAILQELDLKRPIYAQTSAYGHFGRTDLDLPWERTDRVEALQKAVAAAQQSQ

metK

S-adenosylmethionine synthase

411 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.658 kDa

MSRRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYAPIAQLVREKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYESRVEGDEDELDRQGAGDQGLMFGYACDETPELMPLPIHLAHRLSRRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLESLLAPDIREFVVEPELKALVEDGIKLETEGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMSRHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAEPVGLFVETFGTNTIDTDKIEQAISEVFDLRPAAIIRDLDLLRPIYSQTAAYGHFGRSLPEFTWEKTDRVDGCGRPPVWRADLLPLVH

metK

S-adenosylmethionine synthase

410 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.014 kDa

MSETAASGLRLFTSESVTEGHPDKICDAISDTILDALLSVDPHARVAVETVTTTGLVHVVGEVRTSGYVEIPKLVRDKLIEIGFNSSEVGFDGRTCGVSVSIGEQSQEIGAGVDQSHEVRSGENTDADDQAGAGDQGLMFGYATNETATLMPLPIDLAHRLARRLTQVRKTSVVSHLRPDGKTQVTLAYDESGRPVRLDTVVVSTQHDPDVTQEWLFAQIKEHVVDWVLRDSGLESTLDISGYSLLVNPSGSFVVGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSGAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFGTAKFGLTDEQIQDAVLHVFDLRPAAIIRELDLLRPIYAGTAAYGHFGRDDLKLPWENTDRAEQLRDVLSLG

metK

S-adenosylmethionine synthase

410 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.293 kDa

MPSFVFTSESVTEGHPDKICDQVSDAILDALLDQDPNSRVACETVVNTGLCLITGEVTSKAKVDFINLVREVIKEIGYFGAKAGGFDSNSCSVLVALDQQSPDIAQGVDEADDHSGNPFDQVGAGDQGIMFGFACDETPELMPLPISLAHRLSRRLAKVRHDGTLKYLLPDGKTQVSVLYENNKPTAIDTILISTQHTAEVEGITSEKGIREQISKDLWELVVKPATEDLPIKPIQEKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKSLVAAGLASRVEVQLSYAIGVANPVSILVEAFGSGKMSNEALTELVTENFDLRPGAIIEQFGLRSLPNQRQGRFYRDVAAYGHFGRPDLNLPWEDVQDKAKELIESQK

metK

S-adenosylmethionine synthase

410 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.642 kDa

MSQFVFTSESVTEGHPDKICDQISDAVLDALLTQDPHSRVACEAVVNTGLCLITGEVTSTAEVDFINLVRSVIKEIGYKDAQAGGFDANSCAVLVALDKQSPDIAKGVDTAEDHTDDPFDKIGAGDQGIMFGYACNETPELMPLPISLAHRLARQLAKIRHQGTLKYLLPDGKTQVSVIYENNEPIAIDTIVISTQHTSEIDDLSSEADIRERITKDLWEYVVKPATSDLKLQPNQEKTRFLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKSIVAAKLAKRVEVQLSYAIGVANPVSILVEAYGSGKMSNQELTKVVKKHFDLRPGAIIEQFNLKNLPSKRSGRFYRDTAAYGHFGRPDLNLPWEKVDEKAKELIALHN

metK

S-adenosylmethionine synthase

409 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.103 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAVVNTGLCLITGEITSKAEVDFNKLVREVIKNIGYRSASDGGFDANSCAVLVALDQQSSDIAQGVNEAEDHSTDPLDQVGAGDQGIMFGFACDETPELMPLPISLAHRLARRLALVRHQQLIDYLLPDGKTQVSVSYENGVPCSIDTILISTQHKSEVDGITLEEEIQKRIAKDLWKFVVEPATEDLPLKPAKGSTRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAANLAKKVEVQLSYAIGVAKPISILVDSFGTGKVSDSELTQLVQDQFDLRPGAIIKAFDLQNLPSIRGGRFYRDTAAYGHFGRTDILLPWEDVSQKAKELSLLK

metK

S-adenosylmethionine synthase

409 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.134 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDACLSEDPTSRVACEAVVNTGLCLITGEITSKAEVDFNKLVREVIKSIGYRSASDGGFDANSCAVLVALDQQSSDIAQGVNEAEDHSTDPLDQVGAGDQGIMFGFACDETPELMPLPISLAHRLARRLALVRHQQLIDYLLPDGKTQVSVSYENGVPCSIDTILISTQHKSEVDGITLEEEIQKRIAKDLWKFVVEPATEDLPLKPAKESTRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAANLAKKVEVQLSYAIGVAKPISILVDSFGTGKVSDSELTQLVQDQFDLRPGAIIKAFDLQNLPSVRGGRFYRDTAAYGHFGRTDILLPWEDVSQKAKELSLLK

metK

S-adenosylmethionine synthase

408 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.507 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPASRVACETVVNTGLCMITGEVTSKAKVDFIHLVRDVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVNEADDHAGDPLDLVGAGDQGIMFGYACNETPELMPLPISLAHRLARQLAEVRHNGTLDYLLPDGKTQVSVVYENDQPVAIDTILISTQHTAEVGGMSDEQGIRERITEDLWTHVVEPATADLNLKPSREGTKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVASGLAGRAEVQLSYAIGVAKPVSILVESFGTGTVSNEDLTALVQEHFDLRPGAIIENFGLRNLPQARGGRFYQNTAAYGHFGRNDLNLPWEDVAAKAEELRKA

metK

S-adenosylmethionine synthase

408 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.507 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPASRVACETVVNTGLCMITGEVTSKAKVDFIHLVRDVIKEIGYSGARAGGFDANSCAVLVALDQQSPDIAQGVNEADDHAGDPLDLVGAGDQGIMFGYACNETPELMPLPISLAHRLARQLAEVRHNGTLDYLLPDGKTQVSVVYENDQPVAIDTILISTQHTAEVGGMSDEQGIRERITEDLWTHVVEPATADLNLKPSREGTKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVASGLAGRAEVQLSYAIGVAKPVSILVESFGTGTVSNEDLTALVQEHFDLRPGAIIENFGLRNLPQARGGRFYQNTAAYGHFGRNDLNLPWEDVAAKAEELRKA

metK

S-adenosylmethionine synthase

408 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.68 kDa

MAEVKLISAESVTEGHPDKICDQISDAILDDMLRQDPHSHVAVETSATKGQFWVFGEVTSKGYSDIQSIVRDTVRRIGYTSSVIGLDADSCGVLVSLSEQSPEINQGVSRIDSDRENAVSREERYEAQGAGDQGVMFGYASDETDVLMPLPIHLAHRLAYRLAEVRKNGEVKFLRPDGKTQVTIEYDEENRPLRVDTVLISTQHDPEVSQEALREDLREHVIEPVLDEVLGDAVKHDDYRVLVNPTGSFIMGGPAADAGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYAARWVAKNIVAAGLAHKVEVQVAYAIGVAEPVSINVETYGTEADGVTREQIQEAVRKVFDLRPAAIVDELDLLRPIYSKTAAYGHFGREDDDFTWEHTNKVDELKRAIATLVD

metK

S-adenosylmethionine synthase

408 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.938 kDa

MRKFYTSESVSEGHPDKLADFISDSLLDEFLRQEPESRVAVETLVTTGMAVVAGEVRARSAHVDVQKVVREAVQKVGYTRANYGFDAEYSAVLVSIHEQSPEIGGTVDRSEEWRQMTPQERARPENTFSEVGAGDQGLMFGYATDETPELMPLPISLAHRLTRRLAELRKSGALPYLRPDAKAQVTVVRNGEPHEATETHVDTIVISTQHSEDVSQEQIEADMLEHVVRAVIPHELLTPETKFFINPSGRFVIGGPHGDTGLTGRKIIVDTYGGAVPHGGGAFSGKDPTKVDRSAAYYARYIAKNIVAAGLARRALVEVAYAIGRAHPVSLRVDTYGTGTLSDERLADLVRAHFDARPQAIIAELDLQRPIYAQTAAYGHFGRPEFPWEQTNKAEALRRAAEELKQEA

metK

S-adenosylmethionine synthase

408 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.571 kDa

MSKFAVRKFYTSESVSEGHPDKLSDFISDSILDEFLRQEPTSRVAVETLVTTGMAVVAGEVRAHTAHVDIQKTVREAVQRVGYTRANYGFDAEYSAVLVAIHEQSPEIASGVDHSEEWREMSEAERQKPENAYSMVGAGDQGLMFGYATDETPELMPLPISLAHGLTRRLAELRKDGTLPYLRPDAKAQVTVVRNGEPHSATETAVDTIVISTQHSDDVTQEQIRADMLEHVIPAVIPAELLNEQTRYFINPSGRFVIGGPHGDTGLTGRKIIVDTYGGAVPHGGGAFSGKDPTKVDRSAAYYARYVAKNIVAAGLARRALVEIAYAIGRAHPVSLRVDTYGTGTVSDEKLDELIAAHFDARPQAIIAQLDLQRPIYAQTAAYGHFGRPEFPWEQTDRAQALKEAAQG

metK

S-adenosylmethionine synthase

407 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.271 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPASRVACETVVNTGLCIITGEVTTTARVDFNTLVRGVIADIGYSSAKAGGFDANSCAVLVALDQQSPDIAQGVDEADDHAGDPLDKVGAGDQGIMFGYACDETPELMPLPISLAHRLARRLAEVRHNGTLGYLLPDGKTQVSVVYEDDQPVAIDTILISTQHIAEIDGISDEKGLRERISADLWTHVVEPATADLSLKPSKDTTKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAAGLARKAEVQLSYAIGVAKPVSILVESFGTSSHSNDELTELVNANFDLRPGAIIENFKLRNLPQQRGGNFYREVAAYGHFGRSDLNLPWEDVSVIAAKLKG

metK

S-adenosylmethionine synthase

407 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.271 kDa

MSRYVFTSESVTEGHPDKICDQVSDAVLDALLAQDPASRVACETVVNTGLCIITGEVTTTARVDFNTLVRGVIADIGYSSAKAGGFDANSCAVLVALDQQSPDIAQGVDEADDHAGDPLDKVGAGDQGIMFGYACDETPELMPLPISLAHRLARRLAEVRHNGTLGYLLPDGKTQVSVVYEDDQPVAIDTILISTQHIAEIDGISDEKGLRERISADLWTHVVEPATADLSLKPSKDTTKYLVNPTGKFVVGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAAGLARKAEVQLSYAIGVAKPVSILVESFGTSSHSNDELTELVNANFDLRPGAIIENFKLRNLPQQRGGNFYREVAAYGHFGRSDLNLPWEDVSVIAAKLKG

metK

S-adenosylmethionine synthase

407 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.084 kDa

MTDKAAQAVRLFTSESVTEGHPDKICDAISDAILDALLEEDPDAHVAVETLVTTGQVHVVGEVRTSGYVEIPQIVRKTLVEIGFTSSDVGFDGHTCGVNVAIGEQSQEIGAGVDASTEVRSGTFEDDDQYGAGDQGLMFGYATNETPEFMPLPISTAHHLSRRLTHVRKEGIVPSLRPDGKTQVTFAYDENDVPTRLETIVISTQHDPEVTQEWLAEQLRTHVVEWVVNDADLSQYYTEDTELLINPSGSFILGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFGTAHEGLSDADIQAAVNKVFDLRPAAIIRELDLQRPIYRQTAAYGHFGRTDVELPWEDTSRADDLRRAAGL

metK

S-adenosylmethionine synthase

407 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.953 kDa

MSQPTAVRLFTSESVTEGHPDKICDAISDTILDALLTADPLSRVAVETVVTTGIVHVVGEVRTSGYVEIPQLVRRKLIEIGFTSSDVGFDGRTCGVSVSIGEQSQEIADGVDTSQEARGDGHFEEDDRAGAGDQGLMFGYATNETPEFMPLPIAVAHRLARRLTQVRKEGIVPHLRPDGKTQVTFAYDADDNPSHLDTVVISTQHDPEVDSAWLEVQLREHVIDWVIRDAGLEHLATGEITVLINPSGSFILGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFDTAREGLTDEQIQAAVSQVFDLRPAAIIRELDLLRPIYAQTAAYGHFGRTDLDLPWEATNRTGRLREALGLK

metK

S-adenosylmethionine synthase

407 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.177 kDa

MAQPTAVRLFTSESVTEGHPDKICDAISDTILDALLEKDPQSRVAVETVVTTGIVHVVGEVRTSAYVEIPQLVRNKLIEIGFNSSEVGFDGRTCGVSVSIGEQSQEIADGVDNSDEARTNGDVEEDDRAGAGDQGLMFGYATNETEEYMPLPIALAHRLSRRLTQVRKEGIVPHLRPDGKTQVTFAYDAQDRPSHLDTVVISTQHDPEVDRAWLETQLREHVIDWVIKDAGIEDLATGEITVLINPSGSFILGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFDTNKEGLSDEQIQAAVLEVFDLRPAAIIRELDLLRPIYADTAAYGHFGRTDLDLPWEAIDRVDELRAALKLA

metK

S-adenosylmethionine synthase

407 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.375 kDa

MSRRLFTSESVTEGHPDKIADRISDTVLDALLARDPRARVAVETLITTGQVHIAGEVTTTAYAPIAQLVRDTVLSIGYDSSAKGFDGASCGVSVSIGAQSPDIARGVDTAYERRGGGTAPGGPGDELDRQGAGDQGLMFGYACDETPELMPLPINLAHRLSRRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASGIDLDSLLAPDIRRHVVEPVLAGLAEDGIKLDTAGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAEPVGLFVETFGTATVDVERIEQAIGEVFDLRPAAIIRDLDLLRPIYAKTAAYGHFGRELPEFTWERTDRTEQLIAAAGL

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.1 kDa

MRNSFLFTSESVSEGHPDKVADQISDSIVDLFLAKDPEARVACETLTTTQLVVLAGEIRCKGVFEDGEWAPGALDEIEATVRRTVREIGYEQAGFHWNRFRFENNLHGQSPQIAQGVDEGAGKDEGAGDQGIMFGYASDETPDFMPATLDYSHKILERMASDRKAGIAPFLEPDAKSQVTLRYANERPVEATAIVVSTQHAPGYYFHNGEGDEAKYTELRKYVLGVIADVLPAELLTANTVYHINPTGRFEIGGPDGDAGLTGRKIIVDTYGGASPHGGGAFSGKDPTKVDRSAAYITRYLAKNIVAAGLARRCTIQLSYAIGVAEPLSIYVDLHGTGTVDEGRIEAVLPQLVRLTPKGIRTHLGLNKPIYRQTAAYGHFGRQADGDAFPWERTDLVDKLKAALAV

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.386 kDa

MNEYSLFTSESVSEGHPDKIADQISDAVLDAIIARDKQARVACETMVKTGVAIVAGEITTSAWVDLEDLVRRVINDIGYTSSDVGFDGNTCGVLNLIGKQSVDIAQGVDRSKPEDQGAGDQGLMFGYATNETDSYMPAPIHYSHRLVERQAELRKHGLLPWLRPDAKSQLTFRYDAQGKPCAVDAVVLSTQHDPDIDQDELREMVKREIIEEVIPAEWLTETTKYHINPTGNFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNVVAAGLAERCEIQVSYAIGVAEPTSVSVDTFGTGKISDAKIVELVREHFDLRPNAITRMLDLLHPMYQLTAAYGHFGREPFETSYTWTDVGGKQHVETFTAFPWEKTDRADALRQAAGL

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.817 kDa

MTEGHPDKICDQISDTILDALLTEDPSSRVAAEVVVNTGLVLITGEVSTQAQTNLIDLARRKIAETGYTGEDSGFGANNCTVLIALDKQSPDIAQGVDTAQEQRQASSDERFDSIGAGDQGIMFGYACNEAPELMPLPISLSHRLARQLAVVRHNGQLDYLRPDGKTQVTIAYEDGKPVAIDTILISTQHKAAIGDISDDNAVQERIKSDLWEQVVLPVFSDLVIQPDSATRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVLVETFGTGKVADEVLLDLVRKHFELHPAGIIEHFNLQRLPGERGGRFYQEVAAYGHFGRNDLDLPWEQTDKADTLRQEALATTQA

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.817 kDa

MTEGHPDKICDQISDTILDALLTEDPSSRVAAEVVVNTGLVLITGEVSTQAQTNLIDLARRKIAETGYTGEDSGFGANNCTVLIALDKQSPDIAQGVDTAQEQRQASSDERFDSIGAGDQGIMFGYACNEAPELMPLPISLSHRLARQLAVVRHNGQLDYLRPDGKTQVTIAYEDGKPVAIDTILISTQHKAAIGDISDDNAVQERIKSDLWEQVVLPVFSDLVIQPDSATRFLVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVLVETFGTGKVADEVLLDLVRKHFELHPAGIIEHFNLQRLPGERGGRFYQEVAAYGHFGRNDLDLPWEQTDKADTLRQEALATTQA

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.852 kDa

MTEEHRLISAESVTEGHPDKVCDQISDAILDDLLAQDSSSHVAVETSAATGVFLVFGEVTSEGYCDVQSKVRETLRNIGYTSSEVGLDADSCGVVVAITEQSAEINQGVARLTDDQETAASREERYEAQGAGDQGVMFGYATDETPTLMPLPIYLAHRLAFRLTEVRKSGEVPHLRPDGKTQVTIEYDDDDKPVRLDTVLISTQHDPEVTQDWLAVELKKHVIDPVLDEVLGSKVPHDNYRQLVNPTGSFILGGPAADAGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYATRWVAKNIVAAGLAHKVEIQIAYAIGVADPVSVNVETFGTEQGVTRGQIAAAVRKVFDLRPAAIIDELDLKRPIYLKTAAYGHFGRTDVEFPWEKTDKVEELKAAIAAE

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.775 kDa

MTEEHRLISAESVTEGHPDKVCDQISDAILDDLLAQDSSSHVAVETSAATGVFLVFGEVTSEGYCDVQSKVRETLRNIGYTSSEVGLDADSCGVVVAITEQSAEINQGVARLTGDQETAASREERYEAQGAGDQGVMFGYATDETPTLMPLPIYLAHRLAFHLTEVRKSGEVPHLRPDGKTQVTIEYDDDDKPVRLDTVLISTQHDPEVTQDWLAVELKKHVIDPVLDEVLGSKVPHDNYRQLVNPTGSFILGGPAADAGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYATRWVAKNIVAAGLAHKVEIQIAYAIGVADPVSVNVETFGTEQGVTRGQIAAAVRKVFDLRPAAIIDELDLKRPIYLKTAAYGHFGRTDVEFPWEKTDKVEELKAAIAAE

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.83 kDa

MTEEHRLISAESVTEGHPDKVCDQISDAILDDLLVQDPSSHVAVETSAATGVFLVFGEVTSKGYCDVQSKVRETLRNIGYTSSEVGLDADSCGVVVAITEQSAEINQGVARLTGDQETAASREERYEAQGAGDQGVMFGYATDETPTLMPLPIYLAHRLAFRLTEVRKSGEVPHLRPDGKTQVTIEYDDNDKPVRLDTVLISTQHDPEVTQDWLAVELKKHVIDPVLDEVLGSKVPHDNYRQLVNPTGSFILGGPAADAGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYATRWVAKNIVAAGLAHKVEIQIAYAIGVADPVSVNVETFGTEQGVTRGQIAAAVRKVFDLRPAAIIDELDLKRPIYLKTAAYGHFGRTDVEFPWEKTDKVEELKAAIAAE

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.382 kDa

MSQTFGNSSKYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPNAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYTKPEYGFDDRTCGVLTSINRQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSKRLSEVRKNGTLAYLRPDGKSQVTVEYHNGEAKRISSVVIGAQHDPDVTTEKIQADIIREVIKPIIPTNLLDENTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMSHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAIKATMESLSVSK

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.399 kDa

MSQTFGNSSKYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPTAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYIKPEYGFDDRTCGVLTSINRQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSKRLAEVRKNGTLPYLRPDGKSQVTVEYHNGKAKRISSVVIGAQHDPDITTEKIQADIIRNVIKPIIPTNLLDENTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMNHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAIKATIESLSVSK

metK

S-adenosylmethionine synthase

406 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.428 kDa

MSQTFGNSSKYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPTAHVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYIKPEYGFDDRTCGVLTSINRQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSKRLAEVRKNGTLPYLRPDGKSQVTVEYHNGKAKRISSVVIGAQHDPDITTEKIQADIIREVIKPIIPTNLLDEKTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSGKDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMNHEDILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAIKATIESLSVSK

metK

S-adenosylmethionine synthase

405 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.762 kDa

MSVKRGRHLFTSESVTEGHPDKICDQISDAILDEILKKDPNARVACETSVTTGLVLVAGEITTNTYVDIPSVVRQTIKGIGYTRAKYGFDAETCAVLTSIDEQSADIAQGVDKALEAREGQMTDAEIEAIGAGDQGLMFGFATNETEELMPLPISLSHKLSRRLTEVRKNGTLGYLRPDGKTQVTIEYDENDTPVRVDTIVLSTQHAPEVTLEQIQADLKEHVIEAVVPSALIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSGAYAARYVAKNIVAAGLADKCEVQLAYAIGVAQPVSIAVNTFGTGKAAEDVLVELVRKHFDLRPAGIIRMLDLRRPIYKQTAAYGHFGRTDVPLPWEATDKAAALKEDVLKLEAN

metK

S-adenosylmethionine synthase

405 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.492 kDa

MSTSFMKSPRLFFTSESVTEGHPDKICDQVSDAVLDAFLSHDPRARVACETATTTGLIVVIGEVTYEQGYIPIEEIVRKTIKDIGYTDAAYGFDADTCGVMVAIHGQSPDIAQGVNRALEVRSDGQVTEEEVATIGAGDQGMMFGFACNETPELMPLPIALAHRIGRRLSRLRKDGVLPYLRPDGKSQVTIEYSYGRPVRVDTVLVSNQHAPDVTQEQIRHDIIHHVIHEVIPNDLLDEKTKYFVNPTGRFVIGGPMGDSGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYACRWVAKNVVAAGLADRFEIQVSYAIGVARPLSISVECFGTNKVPEETIVRLIDEHFDLRPGAIIRDLRLRRPIYRPTAAYGHFGRDDIDAPWEQTDRAEALRRAAGL

metK

S-adenosylmethionine synthase

405 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.37 kDa

MSTSFMKSPRLFFTSESVTEGHPDKICDQVSDAVLDAFLTHDPRARVACETATTTGLIVVIGEVTYEQGYIPIEEIVRKTVKDIGYTDASYGFDADTCGVMVAIHGQSPDIAQGVDRALEVRGDGYVTDEEVATIGAGDQGMMFGFACNETPELMPLPIALAHRIGRRLSRLRKEGVLPYLRPDGKSQVTVEYSYGRPVRVDTVLVSNQHAPDVTQDQIRHDIIHQVIHAVVPPELIDEKTKYFVNPTGRFVIGGPMGDSGLTGRKIIVDTYGGMARHGGGAFSGKDPTKVDRSAAYACRWVAKNVVAAGLADRFEIQVAYAIGVAHPLSISVECFGTNKVSEETILRLINEHFDLRPGAIIRDLRLRRPIYRPTAAYGHFGRDDIDAPWEQTDRAEALRRAAGL

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.152 kDa

MSQKRYFFTSESVSEGHPDKVADQISDAVLDDFLRQDSTSRVACETFVTTGQVIVGGEVTTKGIVDVQTIARKVITDIGYTKGEYMFEANSCGILSALHSQSPDINRGVDRKEEIADEFDRVGAGDQGMMFGYACTETPELMPAAIQFAQQLVKKLAEIRKEGKMMTYLRPDAKSQVTLEYENDIAKRVDAIVISTQHDPEPAGISEAEWQEIIKKDVIENVIKVLIPANMIDENTKLHINPTGRFEIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAARHVAKNIVAAGLAEKCTVQVSYAIGVARPVSIYINTHDTAKHGLSDNQIQEKAEAIFDLRPAAIIKHFGLDKPNGWCYQQTAAYGHFGRDIFPWEKTDKVAELKAAFKLA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.313 kDa

MSQSRYFFTSESVSEGHPDKVSDQISDAVLDEFLRQDPNSRVACETFVTTGQVIVGGEVTTKGIVDIQKIARRVVTEIGYTKGEYMFEANSCGVLSALHSQSPDINRGVDRKEEIADEFDRVGAGDQGMMFGYACTETPELMPAAIQFAQQLVKKLAEIRKEGKIMTYLRPDAKSQVTLEYIDDKVARVDAVVVSTQHDPEPAGMSEADFQAVIRKDIIENVVKVVIPAELLDENTKFHINPTGRFEIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYASRHVAKNIVAADLADKCTVQVSYAIGVARPVSIYIDTHGTAKHGLDDAEIQAKAEKIFDLRPAAIIRRFNLDRPHGWCYQDTAAYGHFGRDIFPWEKTDKVEELKKAFNLA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.024 kDa

MSQSRYFFTSESVSEGHPDKVADQISDAVLDDFIRQDPNSRVACETFVTTGQVIVGGEVTTTGIVDVQKIARKVITEIGYTKGEYMFEANSCGVLSALHSQSADINRGVDRKEAIADEFDRVGAGDQGMMFGYACTETPELMPAAIQFAQQLVKVLADIRKAGKIMTYLRPDAKSQVTLEYVDEKVARVDAVVVSTQHDPEPAGMSEAEFQEVIKKDIIENVIKKVIPANLLDLNTKFHINPTGRFEIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYASRHVAKNIVAAGLAEKCTVQVSYAIGVARPVSIYINTHGTAMHGLSDEQIQEKAEKIFDLRPLAIIRRFSLDNPQGWCYQETAAYGHFGRDIFPWEKTEKVAELKTAFSLA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.373 kDa

MSHSRYFFTSESVSEGHPDKVSDQISDAVLDEFIKQDPNSRVACETFVTTGQVIVGGEVTTKGIVDIQTIARKTITEIGYTKGEYMFDANSCGVLSALHSQSPDINRGVDRKEEIEDEFDRVGAGDQGMMFGYACTDTPELMPAAIQYAQELVRLLAEIRKEGKIMTYLRPDSKSQVTLEYDENDKVLRVDAVVVSTQHDPEPAGMSEAEFQEVIKNDIIENVIRKVIPAELIDENTKFHINPTGRFEIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAARHVAKNIVAAGLADKCTVQVSYAIGVARPVSIYINTHGTGKHGLSDSQIQEKAEAIFDLRPLAIIRRFNLDRPHGWCYRDTAAYGHFGREQFPWEKTEKVAELKAAFGL

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.081 kDa

MSQSRYFFTSESVSEGHPDKVSDQISDAVLDEFIRQDPDSRVACETFVTTGQVIVGGEVTTKGVVDVQTIARKVITEIGYTKGEYMFDAHSCGVLSALHSQSPDINRGVDRKEEISDELDRVGAGDQGMMFGYACTETPELMPAALQFAQQLVKKLAEIRKEGKIMTYLRPDAKSQVTLEYVDEQVKRVDAVVVSTQHDPEPEGVSEAEWQAVIKKDIIENVINVVIPAALLDEKTKLHINPTGRFVIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYASRHVAKNIVAAGLADKCTVQVSYAIGVAQPVSIYINTHGTAKHGLTDAEIQEKAEVIFDLRPASIIKRFGLNKPEGWCYQETAAYGHFGRENFPWERTEKVEELKKALNVA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.255 kDa

MSQSRYFFTSESVSEGHPDKVSDQISDAVLDSFISQDPNSRVACETFVTTGQVIVGGEVTTTGIVDIQKIARRVITEIGYTKGEYMFDANSCGVLSALHSQSADINRGVDRKEEIADEFDRVGAGDQGMMFGYACTETPELMPAAIQYAQRLVKLLAEIRKAGKIMTYLRPDSKSQVTLEYIDDKVARVDAVVVSTQHDPEPAGMSEAEFQAVIRKDIIENVINKVIPAELLDADTKFHINPTGRFEIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYASRHVAKNIVAAGLADKCTVQVSYAIGVARPVSIYINTHDTAKHGLTDEQIQEKAEKIFDLRPLAIIRRFNLDKPEGWSYQETAAYGHFGRENFPWEKTEKVEELKKAFNLA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.178 kDa

MSHSRYYFTSESVSEGHPDKVADQISDAVLDEFIKQDPNSRVACETFVTTGQVIVGGEVTSKGIVDVQTIARKTITEIGYTKGEYMFDANSCGILSALHSQSPDINRGVDRKEEIADEFDRVGAGDQGMMFGYACTETPELMPAAIQYAQELVRLLAEIRKEGKIMTYLRPDAKSQVTLEYDGNDNVLRVEAVVVSTQHDPEPAGMSEAEFQAVIKNDVIENVIKKVIPAKLIDENTKFHINPTGRFEIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAARHVAKNIVAAGLADKCTVQVSYAIGVARPISIYINTHGTSKHGLSDEQIQEKAEAIFDLRPLAIIRRFNLDRPHGWCYRDTAAYGHFGREQFPWEKTEKVAELKAALGL

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.258 kDa

MSAKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKFGFDADTCAVLTAIDEQSPDIAMGVDQALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPLPISLAHRLSRRLAEVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVISTQHHPEIEHDQIERDMKEHVIKPIVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDVLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLPWERTDKAAVLKEQALALAKNE

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.122 kDa

MSQTRYFFTSESVSEGHPDKVADQISDAVLDDFLRQDSSSRVACETFVTTGQVIVGGEVTTKGIVDIQTIARKVVTEIGYTKSEYMFEANSCGVLSALHSQSPDINRGVDRKEEIADEFDRVGAGDQGMMFGYACTETPVLMPAAIQFAQHLMKKLAEIRKEGKIMTYLRPDAKSQVTLEYENEVVKRVDAVVVSTQHDPEPEGVSEAAWQEVIKNDIIENVIKVVIPADLIDENTKFHINPTGRFVIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAARHVAKNIVAAGLADKCTVQVSYAIGVARPVSIYINTHDTAKHGLNDAQIQEKAELIFDLRPAAIIKRFSLNKPEGWCYQQTAAYGHFGRDIFPWEKTEKVGELKSALNLA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.258 kDa

MSAKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKFGFDADTCAVLTAIDEQSPDIAMGVDQALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPLPISLAHRLSRRLAEVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVISTQHHPEIEHDQIERDMKEHVIKPIVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDVLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLPWERTDKAAVLKEQALALAKNE

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.122 kDa

MSQTRYFFTSESVSEGHPDKVADQISDAVLDDFLRQDSSSRVACETFVTTGQVIVGGEVTTKGIVDIQTIARKVVTEIGYTKSEYMFEANSCGVLSALHSQSPDINRGVDRKEEIADEFDRVGAGDQGMMFGYACTETPVLMPAAIQFAQHLMKKLAEIRKEGKIMTYLRPDAKSQVTLEYENEVVKRVDAVVVSTQHDPEPEGVSEAAWQEVIKNDIIENVIKVVIPADLIDENTKFHINPTGRFVIGGPHGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAARHVAKNIVAAGLADKCTVQVSYAIGVARPVSIYINTHDTAKHGLNDAQIQEKAELIFDLRPAAIIKRFSLNKPEGWCYQQTAAYGHFGRDIFPWEKTEKVGELKSALNLA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.915 kDa

MAELKLISAESVTEGHPDKVCDQISDAILDDMLAQDPHSHVAVETCATVGQFFVFGEVTSEGYSDIQNIVRSVVRNIGYTSSRVGLDADSCGVTVSLTEQSPEINQGVARLSGEEESKASREQRYEAQGAGDQGVMFGYACDETDVLMPLPIHLAHRLAYRLAEVRKSGEVPHLRPDGKTQVTIEYDDDDHPVRLDTVLVSTQHDPEVDQAWLKEQLTEHVIRPVLDDVLADRVAHDEYRVLVNPTGSFILGGPAADAGLTGRKIIVDTYGGAAHHGGGAFSGKDPSKVDRSAAYAARWVAKNIVAAGLAHKVEVQVAYAIGVADPVSINVETYGTEIGVTREQIQQAVRKVFDLRPAAIIDELDLKRPIYSKTAAYGHFGREDADFTWEATNKVDELKEAIKA

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.207 kDa

MSKSGSRLFTSESVTEGHPDKICDAISDSILDALLTQDPRARVAVETLVTTGQVHVAGEVTTTAYADIPKIVRDTVLEIGYDSSAKGFDGNSCGVNVAIGAQSPEIAQGVDHSHEARVDGISDDEIDRQGAGDQGLMFGYATTDTPELMPLPIALAHRLSRRLTEVRKSGVLPYLRPDGKTQVTIEYDGDKAVRLDTVVISTQHAADIDLDNLLTPDLREKVLHSVLTDVNLTDLDTSDVRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNAVAAGLADRIEVQVAYAIGKAAPVGLFVETFGTEKTDPARIQKAITEIFDLRPGAIIRDLDLLRPIYAQTAAYGHFGRTDIDLPWESTDRADKLRSAAGL

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.165 kDa

MSQSGSRLFTSESVTEGHPDKICDAISDSILDALLTDDPRARVAVETLVTTGQVHVAGEVTTSAYADIPKIVRDTVLEIGYDSSAKGFDGNSCGVNVAIGAQSPEIAQGVDHSHEVRTGELSDDEIDRQGAGDQGLMFGFATTDTPELMPLPIALAHRLSRRLTEVRKSGVLPYLRPDGKTQVTIEYDGDKAVRLDTVVISTQHAADIDLDNLLTPDLREKVLGSVLAEIDMPELDVSDIRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNAVAAGLADRIEVQVAYAIGKAAPVGLFVETFGTEKTDPARIQQAITETFDLRPGAIIRDLDLLRPIYAQTAAYGHFGRTDIDLPWESIDRAEKLRAAAGL

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.179 kDa

MSQSGSRLFTSESVTEGHPDKICDAISDSILDALLTDDPRARVAVETLVTTGQVHVAGEVTTTAYADIPKIVRDTVLEIGYDSSAKGFDGNSCGVNVAIGAQSPEIAQGVDHSHEVRTGELSDDEIDRQGAGDQGLMFGFATTDTPELMPLPIALAHRLSRRLTEVRKSGVLPYLRPDGKTQVTIEYDGDKAVRLDTVVISTQHAADIDLDNLLTPDLREKVLGSVLAEIDMPELDVSDIRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNAVAAGLADRIEVQVAYAIGKAAPVGLFVETFGTEKTDPARIQQAITETFDLRPGAIIRDLDLLRPIYAQTAAYGHFGRTDIDLPWESIDRAEKLRAAAGL

metK

S-adenosylmethionine synthase

404 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.965 kDa

MRTSGSRLFTSESVTEGHPDKICDAISDSILDALLAEDPRSRVAVETLVTTGQVHVAGEVTTSAYADIPRIVREKVLEIGYDSSAKGFDGNSCGVNIAIGAQSPDIAQGVDTSHEARVGGTDDEIAKQGAGDQGLMFGYATTDTPELMPLPIALAHRLSRKLTEVRKTGVLPYLRPDGKTQVTIEYDGDRPVRLDTVVISTQHAADIDLDNLLAPDIREKVVDAVLADLDLPSPLDTSDIRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLSERVEVQVAYAIGKAAPVGLFVETFGTEKVDPARIAAAITEVFDLRPGAIIRDLDLLRPIYAPTAAYGHFGRTDIDLPWEHTDRADKLRAAAGL

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.88 kDa

MANTFMNSPRFYFTSESVSEGHPDKMCDQISDAILDAFLSHDPKARVAVETATTTGLIVVLGEVTYERGYIPIEEIVRRTVKEIGYTSAEYGFDADTCGVMVAIHGQSPDIAMGVDKALEAKIGAMADDVEAVGAGDQGMMFGFACDETPELMPASIALAHRLIRRLERVRKDGTLPYLRPDAKSQVTVEYSFGKPVRVDTVLISSQHAPDITQDQIRADLIEHVIKTEIPEAWLDSQTKIFINPTGRFVIGGPMGDSGLTGRKIIVDTYGGVARHGGGAFSGKDPSKVDRSAAYACRWVAKNIVAAGLARRVELQVSYAIGVARPLSLSVETFGTAAVPDEVILKAVNEVFDLRPGAIIRDLDLRRPIYRKTAAGGHFGRTDIDLPWERTNRVEELRRAAGL

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.88 kDa

MANTFMNSPRFYFTSESVSEGHPDKMCDQISDAILDAFLSHDPKARVAVETATTTGLIVVLGEVTYERGYIPIEEIVRRTVKEIGYTSAEYGFDADTCGVMVAIHGQSPDIAMGVDKALEAKIGAMADDVEAVGAGDQGMMFGFACDETPELMPASIALAHRLIRRLERVRKDGTLPYLRPDAKSQVTVEYSFGKPVRVDTVLISSQHAPDITQDQIRADLIEHVIKTEIPEAWLDSQTKIFINPTGRFVIGGPMGDSGLTGRKIIVDTYGGVARHGGGAFSGKDPSKVDRSAAYACRWVAKNIVAAGLARRVELQVSYAIGVARPLSLSVETFGTAAVPDEVILKAVNEVFDLRPGAIIRDLDLRRPIYRKTAAGGHFGRTDIDLPWERTNRVEELRRAAGL

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.23 kDa

MTDLRLFTSESVTEGHPDKICDQISDSILDALLTQDPTSRAAVETLVTTGLVHVAGEVTTSGYVDIPQIVRDRIRDIGYDSSEVGFDGSNCGVTVSIGAQSPDIAQGVDRSYESRSGSASTDAHDLQGAGDQGLMFGYASRDTPVFMPLPIYLAHRLAERLAAVRHSGELAYLRPDGKTQVTIGYEGLVPRTVDTVVLSTQHGPQVSQEDLRREVEEHVIRPVLAAAAEIGIELDSRDATLLINPTGKFEIGGPKGDAGLTGRKIIVDTYGGFSRHGGGAFSGKDPSKVDRSAAYAMRWVAKNAVAAGLADRLEVQVAYAIGKAAPVGLYVETFGTAHVPEERIVRAIRETFDLRPAAIVERLDLLRPIYAQTAAYGHFGRELPDFTWEALDRVADLQSAAGL

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.188 kDa

MTDLRLFTSESVTEGHPDKICDQISDSILDALLTQDPSSRAAVETLVTTGLVHVAGEVTTSGYVDIPQIVRDRIRDIGYDSSEVGFDGSNCGVTVSIGAQSPDIAQGVDRSYESRSGSASTDAHDLQGAGDQGLMFGYASRDTPVFMPLPIYLAHRLAERLAAVRHSGELSYLRPDGKTQVTIGYEGLVPRTVDTVVLSTQHGPQVSQEDLRREVEEHVIRPVLAAAAEIGIELDSRDATLLINPTGKFEIGGPKGDAGLTGRKIIVDTYGGFSRHGGGAFSGKDPSKVDRSAAYAMRWVAKNAVAAGLADRLEVQVAYAIGKAAPVGLYVEAFGTAHVPEDRIVRAIRETFDLRPAAIVERLDLLRPIYAETAAYGHFGRELPDFTWEALDRVADLQSAAGL

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.306 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAQDPRSRVAVETLVTTGQVHVVGEVTTTAKEAFADITNTVRERILDIGYDSSDKGFDGASCGVNIGIGAQSPDIAQGVDTAHETRVEGAADPLDAQGAGDQGLMFGYAINDTPERMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIEFEDDVPVRLDTVVISTQHAADIDLENTLTPDIREKVLNTVLNDLAHDTLDTSSTRLLVNPTGKFVVGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLAERVEVQVAYAIGKAAPVGLFIETFGTATVDPVKIEKIVPEVFDLRPGAIIRDLDLLRPIYAQTAAYGHFGRTDVELPWEQLNKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.017 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVATSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDNVPVRLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDASTVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.125 kDa

MSAKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDRALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPMPISLAHRLARRLAEVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVVSAQHHPEITQEQIQRDIKEQVIKPVVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDILIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAALLKEQALALADK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.22 kDa

MSKKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDKALEAREGQMTDEEIEAIGAGDQGLMFGFACNETKELMPLPISLAHRLARRLSEVRKEAILPYLRPDGKTQVTVEYDENGKPVRIDTIVVSAQHHPEITQEQIERDIKEHVIKPIVPAELIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVASGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDILIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAETLKEQALALAKQ

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.125 kDa

MSAKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPRIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDRALEAREGQMTDEEIEAIGAGDQGLMFGFACNETEELMPMPISLAHRLARRLAEVRKTDVLPYLRPDGKTQVTIEYDENGKPVRVDTIVVSAQHHPEITQEQIQRDIKEQVIKPVVPAELLDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDILIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAALLKEQALALADK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.22 kDa

MSKKRRLFTSESVTEGHPDKICDQISDAILDAILEKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKIVRDTVREIGYTRAKYGFDADTCAVLTSIDEQSPDIAMGVDKALEAREGQMTDEEIEAIGAGDQGLMFGFACNETKELMPLPISLAHRLARRLSEVRKEAILPYLRPDGKTQVTVEYDENGKPVRIDTIVVSAQHHPEITQEQIERDIKEHVIKPIVPAELIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVASGLADKCEVQLAYAIGVARPVSISIDTFGTGKVSEDILIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAETLKEQALALAKQ

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.297 kDa

MRSTYLFTSESVSEGHPDKVSDQISDAIVDLFIGKDPEARVACETLTTTERVILAGEIRGQGIMDTDGNWAPGIEDEIEAAVRQTVKEIGYEQDGFHWETLTFENHLHGQSAHIAQGVDASGNKDEGAGDQGIMFGFACDETPDLMPAPIDYSHKILHRLATDRKNGNAPFLEPDSKSQVTLRYENGKPVACTAVVVSTQHGAGYDEGEKEAELRAYVKRVVADILPDGFLSDATKWHINPTGTFVIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYITRYLAKNVVAAGLATRCTIQIAYAIGVSQPLSLYVDTHGTGTVDDAAIEEAILDIEKLGGLTPRAIRTHLGLNKPIYRVSAAYGHFGRTAEGDRFPWERTDLVEDLKAALA

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.032 kDa

MANDFLFTSESVSEGHPDKVADQISDAILDALLRQDPRSRVAAETLTNTGLVVLAGEISTNAHVDYIQVARDTIRRIGYDDTDYGIDYKGCAVLVAYDKQSNDIAQGVDHASDDHLNTGAGDQGLMFGYACDETPELMPAPIYYAHRLVERQAQLRKDGRLPFLRPDAKSQVTLRYVDGKPHSIDTVVLSTQHHPDQSATATTMKQSFIDAVIEEIIRPVLPKEWLHDTRFLINPTGRFVTGGPQGDCGLTGRKIIVDTYGGACPHGGGAFSGKDPTKVDRSAAYAARHVAKNVVAAGLARQCQIQVAYAIGVAEPMNITVYTEGTGVIADERIAALIKQHFDLRPRGIIQMLDLLRPIYEKTAAYGHFGREEPEFTWERTDKAAALRAAAGLSPGEHHRKEG

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.663 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRADALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.663 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRADALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.678 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADELIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRAEALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.678 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADELIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRAEALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.687 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTHHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADELIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRAEALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.663 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRADALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.663 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRADALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.663 kDa

MSSYLFTSESVSEGHPDKIADQISDAVLDAILAQDKRARVACETMVKTGVAIVAGEVTTSAWIDLEALTRKVILDIGYNSSDVGFDGETCGVLNLIGKQSPDINQGVDRKNPEQQGAGDQGLMFGYATNETDSFMPAAIHLSHRLVEQQAKIRKKKNSALSWLRPDAKSQVTLRYEDGVATAIDAVVLSTQHDPGVKQKDLIEAVREEILKPVLPAKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKIADEQIEKLIRKHFDLRPFGIIQMLDLIHPMYQQTASYGHFGRKPKDFTYTDGTGAQHSATSFSWEKTDRADALRAAAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.608 kDa

MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVDRKKAEEQGAGDQGLMFGYATNETDSYMPAAIHISHRLVEQQAKIRKKSNSLLPWLRPDAKAQITLRYEDGVASAIDAVVLSTQHDPGIKQKDLVEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSASYAVRYVAKNVVAAGLADRCEVQVSYAIGVAEPISISVTTFGTGKIPDDKIEKLICQHFDLRPYGIIKMLDLIHPIYQPSASYGHFGRKPRELAYTNSNGERVVATAFSWEKIDKAEVLRADAKLE

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.634 kDa

MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVDRKKAEEQGAGDQGLMFGYATNETDSYMPAAIHISHRLVEQQAKIRKKSNSPLPWLRPDAKAQITLRYEDGVASAIDAVVLSTQHDPGIKQKDLVEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSASYAVRYVAKNVVAAGLADRCEVQVSYAIGVAEPISISVTTFGTGKISDDKIEKLIRQHFDLRPYGIIKMLDLIHPIYQPSASYGHFGRKPRELAYTNSNGERVVATAFSWEKIDKAEVLRADAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.592 kDa

MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVDRKKAEEQGAGDQGLMFGYATNETDSYMPAAIHISHRLVEQQAKIRKKSNSPLPWLRPDAKAQITLRYEDGVASAIDAVVLSTQHDPGIKQKDLVEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSASYAVRYVAKNVVAAGLADRCEVQVSYAIGVAEPISISVTTFGTGKVPDDKIEKLIRQHFDLRPYGIIKMLDLIHPIYQPSASYGHFGRKPREFAYTNSNGGRVVATAFSWEKIDKAEVLRADAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.608 kDa

MSSYLFTSESVSEGHPDKVADQISDAVLDAILVQDPRARVACETMVKTGVAIIAGEITTSAWVDLEALTRKVIVDIGYNSSDVGFDGATCGVLNLIGKQSPDINQGVDRKKAEEQGAGDQGLMFGYATNETDSYMPAAIHISHRLVEQQAKIRKKSNSLLPWLRPDAKAQITLRYEDGVASAIDAVVLSTQHDPGIKQKDLVEAVREEILKPVLPSKWLHKGTKFHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGSARHGGGAFSGKDPSKVDRSASYAVRYVAKNVVAAGLADRCEVQVSYAIGVAEPISISVTTFGTGKIPDDKIEKLICQHFDLRPYGIIKMLDLIHPIYQPSASYGHFGRKPRELAYTNSNGERVVATAFSWEKIDKAEVLRADAKLE

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.046 kDa

MRKFYTSESVSEGHPDKLADFISDSILDEFLRQEPTSRVAVETLVTTGMAVVAGEVRAITAHVDVQKTVRDAVMKVGYTRANYGFDAEYSAVLVSIHEQSPEIAEGVDHSEEWRGMSEAERALPENAYSLVGAGDQGLMFGYATDETPELMPLPISLAHQLTRRLAELRKNGTLPYLRPDAKAQVTVVRDGDVHDASETLVDTIVISTQHGEDVTQEQIRQDMLKHVIQAVIPAEYLTPDTKYFINPSGRFVIGGPHGDTGLTGRKIIVDTYGGAVPHGGGAFSGKDPTKVDRSAAYYARYIAKNIVAAGLARRALVEVAYAIGRAHPVSLRVDTYGTGTVSDERLAQLVEAHFDARPQAIIAQLDLQRPIYAQTAAYGHFGRPEFPWEQTDRAEALRQAAQG

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.019 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDNVPVQLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDASTVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.019 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDNVPVQLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDASTVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.921 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSILDALLAEDPCSRVAVETLVTTGQVHVVGEVTTLAKTAFADISNTVRERILDIGYDSSDKGFDGASCGVNIGIGAQSSDIAQGVNTAHEVRVEGAADPLDAQGAGDQGLMFGYAINDTPELMPLPIALAHRLARRLTEVRKNGVLPYLRSDGKTQVTIAYEDNVPVRLDTVVISTQHAAGVDLDATLAPDIREKVLNTVIDDLSHDTLDVSSVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLAERIEVQVAYAIGKAAPVGLFVETFGTEAVDPAKIEKAIGEVFDLRPGAIIRDLHLLRPIYAQTAAYGHFGRTDVELPWEQLNKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.921 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSILDALLAEDPCSRVAVETLVTTGQVHVVGEVTTLAKTAFADISNTVRERILDIGYDSSDKGFDGASCGVNIGIGAQSSDIAQGVNTAHEVRVEGAADPLDAQGAGDQGLMFGYAINDTPELMPLPIALAHRLARRLTEVRKNGVLPYLRSDGKTQVTIAYEDNVPVRLDTVVISTQHAAGVDLDATLAPDIREKVLNTVIDDLSHDTLDVSSVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLAERIEVQVAYAIGKAAPVGLFVETFGTEAVDPAKIEKAIGEVFDLRPGAIIRDLHLLRPIYAQTAAYGHFGRTDVELPWEQLNKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.083 kDa

MSEKGRLFTSESVTEGHPDKICDAVSDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVTTTAKEAFADITNIVRERILDIGYDSSDKGFDGASCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDAQGAGDQGLMFGYAINDTPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDRVPVRLDTVVISTQHADDIDLVKTLDPDIREQVLKTVLDDLAHDTLDASAVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGSEAVDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVDLPWERLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.257 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAQDPRSRVAVETLVTTGQVHVVGEVTTTAKEAFADITNTVRERILDIGYDSSDKGFDGASCGVNIGIGAQSPDIAQGVDTAHETRVEGAADPLDAQGAGDQGLMFGYAIKDTPEMMPLPIALAHRLSRRLTEVRKSGVLPYLRPDGKTQVTIEYEDDVPVRLDTVVVSTQHAADIDLENTLTPDIREKVLNTVLDDLAHDTLDTSSTRLLVNPTGKFVVGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTATVDPVKIEKIVPEVFDLRPGAIIRDLDLLRPIYAQTAAYGHFGRTDVELPWEQLNKVDELKRAV

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.047 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDNVPVRLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDASTVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.047 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDNVPVRLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDASTVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.047 kDa

MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDNVPVRLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDASTVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.984 kDa

MSEKGRLFTSESVTEGHPDKICDAVSDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVTTTAKEAFADITNIVRERILDIGYDSSDKGFDGASCGVNIGIGAQSPDIAQGVDTAHEARVEGAADPLDAQGAGDQGLMFGYAINDTPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIAYEDRVPVRLDTVVISTQHADDIDLVKTLDPDIREQVLKTVLDDLAHDTLDASAVRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAEGVEVQVAYAIGKAAPVGLFVETFGSEAVDPVKIEKAIGEVFDLRPGAIIRDLNLLRPIYAPTAAYGHFGRTDVDLPWERLDKVDDLKRAI

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.924 kDa

MKEIRQFTSESVSEGHPDKVADQISDVILDAILAQDRRARVACETLVKTGMVLVAGEITTQAHIDYEQIIRETITEIGYNHSEIGFDGATCAVVNAIGKQSSDIAQGVDRELEEDQGAGDQGMMFGYASDETDVLMPAPITYAHRLVQRQAEIRRNGELPWLRPDAKSQVTLLYEDDVPVAIDAIVLSTQHSPEISQATLREAVIETIIKPVLPADWFAHCRSENIHVNPTGNFIIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAGRYVAKNLVAAGLAERCEVQISYAIGVAEPTSVSVNTFGTGRIAESRLVELIQAHFDLRPVGLLQMLDLIRPIYRKTAAYGHFGREEPEFTWEQTDKAEALRDAAGLGPATAEIINVRSERH

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.705 kDa

MSSYLFTSESVSEGHPDKVADQISDAVLDAILTQDQRARVACETMVKTGVAIVAGEITTSAWIDLEALTRKVIVDIGYDSSDVGFDGATCGVLNLIGKQSPHIAQGVDRKKPEEMGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSPLSWLRPDAKSQVTLRYENGVVSAIDAVVLSTQHAPGIKQKDLIEAVREEIIKPVLPAKWLHKGTKFHINPTGKFEIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKISDDKIEKLIRKHFDLRPYGIIKMLDLVHPMYQQTAAYGHFGRKPKEFSYLNGEGETVNATAFSWEKTDRAAALRADAKLK

metK

S-adenosylmethionine synthase

403 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.721 kDa

MSSYLFTSESVSEGHPDKVADQISDAVLDAILTQDQRARVACETMVKTGVAIVAGEITTSAWIDLEALTRKVITDIGYDSSDVGFDGATCGVLNLIGKQSPHIAQGVDRKKPEEMGAGDQGLMFGYATNETDSYMPAAIHLSHRLVEQQAKIRKKKNSPLSWLRPDAKSQVTLRYENGVVSAIDAVVLSTQHAPGIKQKDLIEAVREEIIKPVLPAKWLHKGTKFHINPTGKFEIGGPVGDCGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLADRCEVQVSYAIGVAEPTSISVTTFGTGKISDDKIEKLIRKHFDLRPYGIIKMLDLIHPMYQQTAAYGHFGRKPKEFSYLNGEGETVNATAFSWEKTDRAAALRADAKLK

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.054 kDa

MRSNYLFTSESVSEGHPDKVADQISDAIVDLFLSKDPEARIACETLTTTQLVVLAGEIRCKGVYEDGAWAPGAEEEIERTVRETVKAIGYEQDGFHWQTFRFENNLHGQSAHIAQGVDASGNKDEGAGDQGIMFGFACDETPDLMPATLYYSHKILETMAADRHSGAAPFLEPDTKSQVTLRFDGGKPVAATAIVVSTQHGKGYDEGAKEAELKAYVKKVVAGVLPADLLSDQTVYHINPTGSFEIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYVTRYLAKNIVAAGLARRCTIQLAYAIGVSEPLSLYVDTHGTGTVADDKIEAAIQGIKELGGLTPRGIRTHLGLNKPIYRKTAAYGHFGRKAEGDHFPWERTDLVDKLKAALA

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.488 kDa

MSRRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYAPIAQLVRDKILEIGYDSSKKGFDGASCGVSVSIGSQSPDIAQGVDTAYENRVEGDEDELDRQGAGDQGLMFGYATDETPTLMPLPIHLAHRLSHRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLDSLLAPDIREFVVEPELKALLDDGIKLETEGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAEPVGLFVETFGTAKVEADKIEQAIATVFDLRPAAIIRDLDLLRPIYSQTAAYGHFGRELPDFTWERTDRVDALRTAVGL

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.46 kDa

MSRRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYADIANLVRGKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYENRVEGDEDELDRQGAGDQGLMFGYASDETPTLMPLPVFLAHRLSKRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLESLLAPDIKEFVVEPELKALLEDGIKIDTENYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTAKVDTEKIEKAIDEVFDLRPAAIIRALDLLRPIYAQTAAYGHFGRELPDFTWERTDRVDALREAAGL

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.387 kDa

MSRRLFTSESVTEGHPDKIADQISDTILDALLREDPTSRVAVETLITTGLVHVAGEVTTKAYADIPNLVRNKVLEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDTAYEKRVEGDEDELDKQGAGDQGLMFGYACDETPELMPLPIHVAHRLSRRLSEVRKNGTIPYLRPDGKTQVTIEYDGDKAVRLDTVVVSSQHASDIDLDSLLAPDIREFVVEHVLAQLVEDGIKLDTEGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTAAVDTEKIENAIGEVFDLRPAAIIRDLDLLRPIYAQTAAYGHFGRELPDFTWERTDRVDALRAAAGL

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.087 kDa

MKKEKRLFTSESVSEGHPDKVADQISDAILDAILAKDPDGRVACETTVTTGLVLVVGEISTSAYVDIQSVVRKTILEIGYNRPELGFDGNNCAILVDIDEQSSDIADGVNESLETRENQQDKDDLDKIGAGDQGLMFGFAIKETPELMPLPISLAHSLMRRVASLRKEGRLDWLRPDAKAQVTVEYDDENKPKRIDTVVISTQTDATVSNDEIREAMIDMVIKKVIPSQYLDKDTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDLTKVDRSASYAARYVAKNIVAAGLAYQCEIQLAYAIGVAHPVSIMVDTHGTSKVSEDLLVEAVRNVFDLRPAGIIEMLNLKRPIYRQTAAYGHFGRTDVDLPWEHTDKVEALKTYVSEHAE

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.943 kDa

MSEARLFTSESVTEGHPDKICDAISDSVLDALLAGDPKSRVAVETLVTTGQVHVVGEVTTNAKEAFADITNTVRERILEIGYDHSDKGFDGETCGVNIGIGRQSPDIAQGVDTAHETRVGGAADPLDSQGAGDQGLMFGYAIADTPELMPLPIALAHRLSRKLTEVRKNGTLDYLRPDGKTQVTVQYDGTTPVRLDTVVLSTQHADGIELDSQLEPEIKQHVIDAVLTELGHQTLDTSNPRILVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGSETVDPVKIEKAIGEVFDLRPGAIVRDLDLLRPIYAPTAAYGHFGRTDIELPWEQLNKVDDLKSAV

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.979 kDa

MSKGRLFTSESVTEGHPDKICDAISDSVLDSLLAQDPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRHRILEVGYDSSDKGFDGTTCGVNIGIGAQSPDIAQGVDTAHETRVEGAGDPLDLQGAGDQGLMFGYAIKDTPELMPLPIALAHRLARRLTEVRKNGVLDYLRPDGKTQVTVQYDGVTPVRLDTVVLSTQHAEGIDLEGTLTPDIREKVVNTVLSDLNHDSMDTSDFRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLADRVEVQVAYAIGKAAPVGLFVETFGTETVDPAKIEKAITEVFDLRPGAIVRDLDLLRPIYAPTAAYGHFGRTDIDLPWERTDKADALKTAV

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.979 kDa

MSKGRLFTSESVTEGHPDKICDAISDSVLDSLLAQDPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRHRILEVGYDSSDKGFDGTTCGVNIGIGAQSPDIAQGVDTAHETRVEGAGDPLDLQGAGDQGLMFGYAIKDTPELMPLPIALAHRLARRLTEVRKNGVLDYLRPDGKTQVTVQYDGVTPVRLDTVVLSTQHAEGIDLEGTLTPDIREKVVNTVLSDLNHDSMDTSDFRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLADRVEVQVAYAIGKAAPVGLFVETFGTETVDPAKIEKAITEVFDLRPGAIVRDLDLLRPIYAPTAAYGHFGRTDIDLPWERTDKADALKTAV

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.979 kDa

MSKGRLFTSESVTEGHPDKICDAISDSVLDSLLAQDPRSRVAVETLVTTGQVHVVGEVTTSAKEAFADITNTVRHRILEVGYDSSDKGFDGTTCGVNIGIGAQSPDIAQGVDTAHETRVEGAGDPLDLQGAGDQGLMFGYAIKDTPELMPLPIALAHRLARRLTEVRKNGVLDYLRPDGKTQVTVQYDGVTPVRLDTVVLSTQHAEGIDLEGTLTPDIREKVVNTVLSDLNHDSMDTSDFRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLADRVEVQVAYAIGKAAPVGLFVETFGTETVDPAKIEKAITEVFDLRPGAIVRDLDLLRPIYAPTAAYGHFGRTDIDLPWERTDKADALKTAV

metK

S-adenosylmethionine synthase

402 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.813 kDa

MSDARLFTSESVTEGHPDKICDAISDSVLDALLADDPKSRVAVETLVTTGQVHVVGEVTTTAKAAFADITNTVRERILEIGYDHSDKGFDGLTCGVNIGIGKQSPDIAQGVDTAHETRVEGAADPLDSQGAGDQGLMFGYAIADTPELMPLPIALAHRLSRKLTEVRKNGTLDYLRPDGKTQVTVQYDGTTPVRLDTVVLSTQHADGIDLESQLAPEIKQHVIDAVLTELGHDTLDTSAPRILVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAQRVEVQVAYAIGKAAPVGLFVETFGSETVDPVKIQKAIGEVFDLRPGAIVRDLDLLRPIYAPTAAYGHFGRTDIELPWEQLDKVDDLKAAV

metK

S-adenosylmethionine synthase

401 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.459 kDa

MRTDYLFTSESVSEGHPDKVSDQISDAIVDLFLSKDPEARIACETLTTTQLVVLAGEIRCKGVYENGEWAPGAQDEIEKTVRDTVKRIGYEQDGFHWERLEFINRLHGQSAHIAQGVDAADNKDEGAGDQGIMFGYATDETPDLMPATLYYSHKILERMAADRHSGAAPFLEPDAKSQVTLRYEGSLPVAATAVVVSTQHAPGYDEGGKEAELHEYVKRVVAEVIPPVLLRETKYYINPTGSFEIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYITRYLAKNVVAAGLATRCTIQIAYAIGVSEPLSLYVDTHETGTVGDDKIEQAILGIAKLGGLTPRAIRTHLGLNKPIYRPTAAYGHFGRKADGDFFPWERLDLVDDLKAAFA

metK

S-adenosylmethionine synthase

401 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.459 kDa

MRTDYLFTSESVSEGHPDKVSDQISDAIVDLFLSKDPEARIACETLTTTQLVVLAGEIRCKGVYENGEWAPGAQDEIEKTVRDTVKRIGYEQDGFHWERLEFINRLHGQSAHIAQGVDAADNKDEGAGDQGIMFGYATDETPDLMPATLYYSHKILERMAADRHSGAAPFLEPDAKSQVTLRYEGSLPVAATAVVVSTQHAPGYDEGGKEAELHEYVKRVVAEVIPPVLLRETKYYINPTGSFEIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYITRYLAKNVVAAGLATRCTIQIAYAIGVSEPLSLYVDTHETGTVGDDKIEQAILGIAKLGGLTPRAIRTHLGLNKPIYRPTAAYGHFGRKADGDFFPWERLDLVDDLKAAFA

metK

S-adenosylmethionine synthase

401 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.194 kDa

MSKRLFTSESVTEGHPDKICDAISDTILDAMLTEDPQARVAVETVVTTGLVHVVGEVRTSGYVEIPQLVRDTLKEIGFTSSDMGFDGTTCGVSVSIGAQSPEIGAGVDTSHEVRGSSSTDEDDRQGAGDQGLMFGYATNETPEYMPLPISVAHRLSRRLTEVRKEEIVTGLRPDGKTQVTFEYDDAGTPVRLDTVVISTQHDPERTQDELRELLSEHVVGHVLADESLKPFVTEDLNLLVNPSGSFILGGPAGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYATRWVAKNIVAAGLADRAEVQVAYAIGVARPVGLYVETFGTEKAPVEDIQRAVAEVFDLRPASILRELDLLRPIYAQTAAYGHFGRNDLDLPWERLDKVEELKKAVGGN

metK

S-adenosylmethionine synthase

401 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.332 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETCVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEAREGQSDDFNAIGAGDQGLMFGFAIDETPELMPLPISLSHQLVRRLATLRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEVSNDQIRQDMIEQVIKAVIPAHYLDEKTRFLINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLASKAEVQLAYAIGVAQPVSVRVDTFGTSTVSESILEAAVRQVFDLRPAGIIKMLDLKRPIYRQTAAYGHMGRTDIDLPWEQLDKVSPLTEAVAALSEGA

metK

S-adenosylmethionine synthase

401 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.341 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETCVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEAREGQSDDFNVIGAGDQGLMFGFAIDETPELMPLPISLSHQLVRRLATLRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEVSNDQIRQDMIEQVIKAVIPAHYLDEKTRFLINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLASKAEVQLAYAIGVAQPVSVRVDTFGTSTVSESILEAAVRQVFDLRPAGIIKMLDLKRPIYKQTAAYGHMGRTDIDLPWEHLDKVSPLTEAVAALSEGA

metK

S-adenosylmethionine synthase

401 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.055 kDa

MKKMLFTSESVTEGHPDKICDQISDTILDAILEKEPEENKMNARCAVETLVTRGLVVVTGEVRTSAYIDVPTLVRNTILDIGYNRAKFGFDGETCAVITSIEEQSPDIALGVDRSFEVKSKEKEDPFEKIGAGDQGIMFGYATNETDAYMPLPILLAHRLAKRLADVRKSNTLDFLRPDGKTQVTVEYDENNNPVGVETVLISAQHSPDISRQELEEAIKEHVITPVIPENLVTKDTKILVNPTGRFVIGGPQADTGLTGRKIIVDTYGGWAPHGGGAFSGKDPTKVDRSATYMARYVAKNLVASGAADEVLIQLSYAIGVAQPVSINIDTKGTAKVDEEKIYKVVKEIFDFRPAAIISNLNLLQPIYQKTAAYGHFGRKDVEFPWERLDKVKELKAALGL

metK

S-adenosylmethionine synthase

401 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.311 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETCVYTGSVHVFGEISTTAYVDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEAREGQSDDFNVIGAGDQGLMFGFAIDETPELMPLPISLSHQLVRRLAALRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEVSNDQIRQDMIEQVIKAVIPAHYLDEKTRFLINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLASKAEVQLAYAIGVAQPVSVRVDTFGTSTVSESILEAAVRQVFDLRPAGIIKMLDLKRPIYKQTAAYGHMGRTDIDLPWEHLDKVSPLTEAVAALSEGA

metK

S-adenosylmethionine synthase

400 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.195 kDa

MTQRLFTSESVTEGHPDKICDAISDSILDAMLAVDPDSHVAVETVVTTGQVHVVGEVRCRGYVEIPSLVRQTLRNIGFLSSDMGFDGATCGVSVSIGEQSLEIGAGVDTALEARDGAEVEDDDRAGAGDQGLMFGYATNETPEYMPLPIALAHRLARRLTAVRKDDIVPHLRPDGKTQVTLAYNDDNNPIRIDTIVISTQHDPGVSRQWLEEQLRTNVITPVIKDAGVENLVDDELTVLINPSGSFVVGGPMGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRCEVQVAYAIGRANPVGLYVETFGTEKEPISAIQEAVQKVFDLRPAAIIRELDLKRPIYAQTAAYGHFGRTDLDLPWERLDRVDDLKAAISR

metK

S-adenosylmethionine synthase

400 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.626 kDa

MSQNRRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRDTIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAQGVDKALEAREGTMTEEELDAIGAGDQGLMFGFANNETEELMPLPISLAHKLSLRLTEVRKDQTLAYLRPDGKTQVTVEYDDQNKPVRIDTVVISTQHAPEVTLEQIQSDLKEHVISPVVPSELIDEQTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADSCEVQLAYAIGVAQPVSISIDTFGTGKASEEKLIEVVRANFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDLDLPWEKTDKADTLRQEALGQ

metK

S-adenosylmethionine synthase

400 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.043 kDa

MSKNRRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRQTIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGTMSDEEIEAIGAGDQGLMFGYACNETKELMPLPISLAHKLARRLSEVRKEDILPYLRPDGKTQVTVEYDENNKPVRIDAIVISTQHHPEITLEQIQRNIKEHVINPVVPEELIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAELADSCEVQLAYAIGVAQPVSISINTFGSGKASEEKLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDVDLPWERTDKAEQLRKEALGE

metK

S-adenosylmethionine synthase

400 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.901 kDa

MSKNRRLFTSESVTEGHPDKICDQISDSILDEILKNDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRETIKEIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGTMSDAEIEAIGAGDQGLMFGYACNETKELMPLPISLAHKLARRLSEVRKEDILPYLRPDGKTQVTVEYDENNKPVRIDAIVISTQHHPEITLEQIQRNLKEHVINPVVPEELIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADSCEVQLAYAIGVAQPVSISINTFDTGKASEEKLIEVVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRHDVDLPWERTDKADALRKEALGE

metK

S-adenosylmethionine synthase

400 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.888 kDa

MSKNRRLFTSESVTEGHPDKICDQISDSILDEILKKDPNARVACETSVTTGLVLVSGEITTSTYVDIPKTVRETIKEIGYTRAKYGFDAETCAVLTSIDEQSPDIAMGVDQALEAREGAMSDAEIEAIGAGDQGLMFGFACNETKELMPLPISLAHKLSRRLTEVRKEEILPYLRPDGKTQVTVEYDENNKPIRIDTIVISTQHHPEISLEQIQRNLKEHVINPVVPKELIDENTKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADSCEVQLAYAIGVAQPVSISIDTFGTGKASEETLIEVVRKNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRLDLDLPWERTDKADQLKKDALGE

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.555 kDa

MAKNRHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGSEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTHLFPEVIDASFLDENTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.623 kDa

MAKNRHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.623 kDa

MAKNRHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.623 kDa

MAKNRHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGKEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNELFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.551 kDa

MAKNRHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGNEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTNKLDYLRPDAKTQVTVEYDEFNQPVRIDTIVVSTQHHPDITQEQIAKDLHTYLFPEVIDASFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQVAYAIGVARPVSISIDTYGTSDYSEQELIDGVNALFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.545 kDa

MAKNRHLFTSESVSDGHPDKIADQISDAILDAIISKDPDARVACETTVTTGLVLVAGEITTSVYVDIPKIVRDTIKEIGYTRAKYGFDAETCAVLTAIDEQSPDIAQGVDEALESRSGSEIDAAIEAIGAGDQGLMFGFATDETEELMPLPIFLAHGLARKLTELRKTKKLDYLRPDAKTQVTVEYDELNQPVRIDTIVVSTQHHPDITQEEIAKDLHTYLFPEVIDPSFLDEDTKYFINPTGRFVIGGPLGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLAKKVEVQLAYAIGVARPVSISIDTYGTSDYSEQELIDGVNALFDLRPAGIIHMLDLRRPIYRQTAAFGHFGRSDLDLPWERTDKAEALKKLIVK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.657 kDa

MTRRLFTSESVTEGHPDKIADQISDGILDALLAEDPRSRVAVETLITTGQVHVAGEVTTGAYADIPAIVRRTILDIGYDSSRKGFDGASCGVSVSIGSQSADIAQGVDNAFELRTGASESALDAQGAGDQGMMFGFACSETPELMPMPIALAHRLSRRLAQVRREGVVPYLRPDGKTQVTVEYEGLRPVRLNTVLVSSQHAADVSLDSLLTPDIRDHVIAPEVEGLGLGLDVEDYRLLVNPTGRFEVGGPMGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERCEAQVAYAIGKAHPVSLFVETFGTETVPVERIEKAVTEVFDLRPAAIIRDLQLLRPIYSQTAAYGHFGRELPDFTWESTDRAADLKSVAGA

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.76 kDa

MTRRLFTSESVTEGHPDKIADQISDGILDALLAEDPRSRVAVETLITTGQVHVAGEVTTQAYADIPSIVRRTILDIGYDSSRKGFDGASCGVSVSIGSQSADIAQGVDNAFELRTGASESALDAQGAGDQGMMFGFACSETPELMPMPIALAHRLSRRLAQVRREGVVPYLRPDGKTQVTVEYEGLRPVRLNTVLVSSQHAADVSLESLLTPDVREHVIAPEVEGLGLGLDVEDYRLLVNPTGRFEVGGPMGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERCEAQVAYAIGKAHPVSLFIETFGTETVPVERIEKAVTEVFDLRPAAIIRDLKLTRPIYSQTAAYGHFGRELPDFTWESTDRAADLKSVAGA

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.262 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILAKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADKAEVQLAYAIGVAQPVSISVDTLGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLTWERTDKAATLKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.847 kDa

MEKRLFTSESVSEGHPDKVADQISDAILDAMLKKDPNSHVACETIVTTGMVFVFGEISTSAYVDIQDVVRKTILKIGYDRPELGFDGNNCAVMVDIDEQSPDIADGVDHSLETRENKSDNDELDQIGAGDQGLMFGFAIKETPELMPLPISLSHRLMRRVASLRKDHTLEWLRPDAKAQVTVEYDENGKPLCVDTVVISTQTDAEVSNEEICRAMIDLVIKEVIPAKYLDENTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSASYAARYVAKNIVAAGLAYRCEVQLAYAIGVAHPVSIMIDTAGTGTVDDELLTEAVRNVFDLRPAGIIKMLDLRRPIYEQTAAYGHFGRTDVDLPWEKTDKTQALLDYIKNNQ

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.993 kDa

MTYNKRLFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTTTYVDIPKVVRETIKDIGYTRAKYGYDSQTMAVLTAIDEQSPDIAQGVDKALEYRNDISEEEIEATGAGDQGLMFGYATDETDTYMPLPIFLSHQLAKRLADVRKDEILDYLRPDGKVQVTVEYGEDDKPRRIDTIVVSTQHAEDVELAQIEKDIKTHVIYPTVDKALLDDETKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLAKQCEVQLAYAIGVAEPVSISINTFDTGKVSEARLVEAVRKHFDLRPAGIIKMLDLKQPIYRQTAAYGHFGRTDVLLPWEKLDKVNVLKDAVEIQ

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.993 kDa

MTYNKRLFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTTTYVDIPKVVRETIKDIGYTRAKYGYDSQTMAVLTAIDEQSPDIAQGVDKALEYRNDISEEEIEATGAGDQGLMFGYATDETDTYMPLPIFLSHQLAKRLADVRKDEILDYLRPDGKVQVTVEYGEDDKPRRIDTIVVSTQHAEDVELAQIEKDIKTHVIYPTVDKALLDDETKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLAKQCEVQLAYAIGVAEPVSISINTFDTGKVSEARLVEAVRKHFDLRPAGIIKMLDLKQPIYRQTAAYGHFGRTDVLLPWEKLDKVNVLKDAVEIQ

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.592 kDa

MMRASYLFTSESVSEGHPDKVCDRISDEIVDLFYREGPKAGIDPWQIRAACETLATTNKVVIAGETRGPASVTNEHIEHVVREAIKDIGYEQAGFHWKTCDIEILLHPQSADIAQGVDALQPGEVKEEGAGDQGIMFGYACNETPDLMPAPIFYAHKILRLIAEARHSGVEKVLGPDSKSQVTVRYENGKPVGVREIVVSHQHLVEDMTSAQVRERVEPYVREALPKDWITKDTIWHINPTGKFFIGGPDGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYLAKNIVAAGLADRCTLQLAYAIGVARPLSIYIDTHGTGKVSEDKLEKAAAEVMNLTPRGIRSHLDLNRPIYARTAAYGHFGRTPDNEGGFSWEKTDLAEAFKRAV

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.682 kDa

MMRASYLFTSESVSEGHPDKVCDRISDEIVDLFYREGPKAGIDPWQIRAACETLATTNKVVIAGETRGPSSVTNEHIEHVVREAIKDIGYEQEGFHWKTCDIEILLHPQSADIAQGVDALQPGEVKEEGAGDQGIMFGYACNETPDLMPAPIFYAHKILRMIAEARHSGVEKVLGPDSKSQVTVRYENGKPVGVREIVVSHQHLIPDMTSAQVRERVEPYVREALPKDWITKDTIWHINPTGKFYIGGPDGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYLAKNIVAAGLADRCTLQLAYAIGVARPLSIYIDTHGTGKVSEDKLEKAAAEVMNLTPRGIRSHLDLNRPIYARTAAYGHFGRTPDNEGGFSWEKTDLAEAFKRAV

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

44.108 kDa

MERRLFTSESVSEGHPDKVADQISDAILDAMLEKDPNSHVACETIVTTGMVFVFGEISTNAYVDIQDVVRKTILRIGYDRPELGFDGNNCAVMVDIDEQSPDIAGGVDHSLETRENESDQDELDQIGAGDQGLMFGFAIKETPELMPLPISLAHRLMRRVASLRKDHTLDWLRPDAKAQVTVEYDENNNPLRVDTVVISTQTDAEVSNKEIRRAMIDLVIKEVIPARYLDEKTKFLINPSGRFVIGGPKGDSGLTGRKIIVDTYGGYARHGGGAFSGKDSTKVDRSASYAARYVAKNIVAAGLAYRCEVQLAYAIGVAHPVSIMIDTAGTGKVDDDLLTEAVRHVFDLRPAGIIKMLDLRRPIYEQTAAYGHFGRTDVDLSWEKTDKTQDLLDYIKNNK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.017 kDa

MSEKHLFTSESVSEGHPDKVADQISDAILDAILAQDPHAHVACETVVYTGTVNVFGEISTSAYVDIAHVVRETIKKIGYTDSENGFDYKSVGVHVSLVEQSSDIAQGVNEAEEVRDKNGQLVDPLDLIGAGDQGMMFGFATNETAEYMPLAISLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDDNGKAKRIDTVVISTQHAASARNEEIHDDVINKVIKAVIPAELLDDETKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYAPHGGGAFSGKDATKVDRSASYAARYVAKNIVAAGLAEKAQIQLSYAIGVATPTSINVDTFGTGKVSDDELLAAIRKVFDLRPAGIIQMLDLLRPIYGQTAAYGHFGRTDVELPWEQTDKVEELKSVLGK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.973 kDa

MSEKHLFTSESVSEGHPDKVADQISDAILDAILAQDPHAHVACETVVYTGTVNVFGEISTSAYVDIAHVVRETIKKIGYTDSENGFDYKSVGVHVSLVEQSSDIAQGVNEAEEVRDKNGQLVDPLDLIGAGDQGMMFGFATNETAEYMPLAISLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDNNGKAKRVDTVVISTQHAATATNEEIHDDVINKVIKAIIPAELLDDETKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYAPHGGGAFSGKDATKVDRSASYAARYVAKNIVAAGLADKAQIQLSYAIGVATPTSINVETFGTGKVSDDELLAAIRKVFDLRPAGIIQMLDLLRPIYGQTAAYGHFGRTDIELPWEQTDKVEELKAVLGK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.02 kDa

MSEKHLFTSESVSEGHPDKVADQISDAILDAILAQDPHAHVACETVVYTGTVNVFGEISTSAYVDIAHVVRETIKKIGYTDSENGFDYKSVGVHVSLVEQSSDIAQGVNEAEEVRDKNGQLVDPLDLIGAGDQGMMFGFATNETAEYMPLAISLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDNNGKAKRVDTVVISTQHAAAATNEEIHDDVINKVIKAIIPAELLDDETKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYAPHGGGAFSGKDATKVDRSASYAARYVAKNIVAAGLADKAQIQLSYAIGVATPTSINVETFGTGKVSDDELLAAIRKVFDLRPAGIIQMLDLLRPIYGQTASYGHFGRTDIELPWEQTDKANELKAMLEK

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.739 kDa

MQERHLFTSESVSEGHPDKIADQISDAILDAMLEQDPQARVACETTVTTGLVLVVGEISTTAYVDIQKVVRETIKKIGYRDGQYGFDGDNCAVIVALDEQSPDIAQGVDDSLESREKDEDPLDKIGAGDQGLMFGFAVDQTPELMPLPIALSHRLMRKVAELRKSGQLAYLRPDAKAQVTVEYDENEQPKRVDTVVISTQHDEDVTLETIQKDMLEQVIKTVIPAEYLDDKTKYFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLARKCEVQLAYAIGVAQPVSVSVNTFETGTVSEEAIQTAIRENFDLRPAGIIKMLDLQRPIYKQTAAYGHFGRTDVDLSWERLDKVDALKASIAKLNH

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.59 kDa

MSKGRLFTSESVTEGHPDKICDAISDSVLDALLEQDPKSRVAVETLVTTGQVHVAGEVTTTAYADIPKIVRDRILDIGYDSSTKGFDGASCGVNVAIGAQSPDIAQGVDTAHETRVEGKADPLDLQGAGDQGLMFGYAIGDTPELMPLPIALAHRLARRLTEVRKNGVLDYLRPDGKTQVTIQYDGTTPVRLDTVVLSTQHADGIDLEGTLTPDIREKVVNTVLADLGHETLDTSDYRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGSETVDPAKIEKAIGEVFDLRPAAIVRDLDLLRPIYAPTAAYGHFGRTDIELPWEQTNKVDDLKSAI

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.59 kDa

MSKGRLFTSESVTEGHPDKICDAISDSVLDALLEQDPKSRVAVETLVTTGQVHVAGEVTTTAYADIPKIVRDRILDIGYDSSTKGFDGASCGVNVAIGAQSPDIAQGVDTAHETRVEGKADPLDLQGAGDQGLMFGYAIGDTPELMPLPIALAHRLARRLTEVRKNGVLDYLRPDGKTQVTIQYDGTTPVRLDTVVLSTQHADGIDLEGTLTPDIREKVVNTVLADLGHETLDTSDYRLLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGSETVDPAKIEKAIGEVFDLRPAAIVRDLDLLRPIYAPTAAYGHFGRTDIELPWEQTNKVDDLKSAI

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.263 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.263 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.291 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAVALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.263 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.263 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.264 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.268 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLADKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.291 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAVALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.282 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.277 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLTWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.533 kDa

MTKQRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDRALEAREGQMTDAEIEAIGAGDQGLMFGFACNETKELMPLPISLAHKLARRLTEVRKDETLEYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPEITWEQIDRDLKEHVIKAVVPAELMDEETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAKPVSISVDTFGTGKVSEEVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLPWERTDKAADLKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.263 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.282 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKDDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELMDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.263 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLSWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.795 kDa

MADTRSRRLFTSESVTEGHPDKICDQISDSILDEILKEDPNARVACETSVTTGLVLVAGEITTSTYVDIPKVVRDTIRNIGYTRAKYGFDSETCAVLTSIDEQSPDIAQGVNQALEAREGQMTDAEIEAIGAGDQGLMFGYANNETPELMPLPISLSHKLARRLSEARKGEILPYLRPDGKTQVTVEYDENDQSVRIDTIVISTQHHPEVTLEQIESDLKQHVIRSVVPEELIDEETKYFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARYVAKNIVAAGLADKCEVQLAYAIGVAKPVSISIDTFGTGQVSEARLVELVREHFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVELPWEQTDKAEILRQQA

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.277 kDa

MTKKRHLFTSESVTEGHPDKICDQISDSILDAILSKDANARVACETTVTTGLVLVAGEITTSTYVDIPKIVRETIQGIGYTRAKYGFDAETCAVLTSIDEQSADIAMGVDQALEAREGQMTDAEIEAIGAGDQGLMFGFACNETQELMPLPISLAHKLARRLTEVRKNDTLSYLRPDGKTQVTVEYDENGKPVRVDTIVISTQHHPDVTWEEIDRDLKEHVIKAVVPAELIDGETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAEKAEVQLAYAIGVAQPVSISVDTFGTGKVSEDVLVELVRNNFDLRPAGIIKMLDLRRPIYKQTAAYGHFGRTDVDLTWERTDKAAALKEQAGL

metK

S-adenosylmethionine synthase

399 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.71 kDa

MSEYLFTSESVSEGHPDKVADQISDSILDAILAQDPNARVACETLCSTGLIVMSGEITTQANVDYMQVARAAVKRIGYNSSDIGFDYNTCAVLTAFNKQSPDIARGVNRTKEEEMDQGAGDQGLMFGYACDETPQLMPMPIYYAHRLMERQAELRKDGRLPWLRPDAKSQVSVRYLDGKPQRIETVVISTQHHPDISHTDLSEAIIEEVIKPVLPKKMLSGETRYLINPTGRFVVGGPMGDCGLTGRKIIVDSYGGTAHHGGGAFSGKDPSKVDRSAAYAGRYVAKNLVAAGIASRCEVQMAYAIGVARPVSLMVDTFGTGKIPDDKIVKLIERHFDLRPRGIIHGLDLLRPIYEKTAAYGHFGRDEPEFSWESTDKAAQLREEAGIEPAETEPLSLQA

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.79 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVKY

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.79 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVKY

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.79 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVKY

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.79 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVKY

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.79 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVKY

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.491 kDa

MATRLFTSESVTEGHPDKIADQVSDSILDAMLKDDPKSRVAVETMITTGQVHVAGEVTTKTYVDIASVVRERILEIGYDSSKKGFDGASCGVSVSIGSQSPDIAQGVDTAHEARVEGSTEDDLDRQGAGDQGLMFGFACDETPELMPLPIALAHRLARRLSAVRKDGQVGYLRPDGKTQVTIEYEDGKPVRLDTVVVSSQHAADIDLDTLLAPDVAEYVVEPELALLEISTEGRRLLVNPTGRFEIGGPMGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAHPVGLFVETFGTGKVPDAQIQDAVTQVFDLRPAAIVRDLDLLRPIYAQTAAYGHFGRPELDFTWEATSRADALTAAVKG

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.556 kDa

MAANRRLFTSESVTEGHPDKMSDQISDAILDEILKKDPNARVACETTVTTGLVLVSGEISTSTYVDIPALVRETVKEIGYTRAKYGFDFETCAVLTAIDEQSADIAGGVNQALEARQGKMSEEEIDAIGAGDQGLMFGYACDETEELMPLPISLAHQLSKRLADVRKEGIVDYLRPDGKTQVTVEYDENDKPERIDTIVISTQHHSEIQNEQIERDMIEKVIQAVVPSELLDDKTKYFINPTGRFVIGGPQGDVGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAKSCEVQLAYAIGVAQPVSIAVNTFGTGKVSEDRLVEAVRELFDLRPAGIIRMLDLRKPIYKNTAAYGHFGRKDILFPWEKTDKTEELIALTK

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.76 kDa

MTEQKGRYLFTSESVTEGHPDKMADQISDAVLDAILALDPRARVACETLLTTGLVVVTGEITTHAYVDIPNLVRDVVRDIGYTRAKYGFDGSTCGVMTAIDPQSPDIAQGVDVAIEVRGEVNEKELEIGAGDQGMMFGFACDETPELMPLPISLAHRLARRLAQVRKNGTLPYLRPDGKTQVTIEYEDGRPKRIDTIVISAQHDPDTTQEQIRKDVIDYVILDVVDRNLIDDRTRYFINPTGRFVVGGPQGDTGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARWVAKNIVAAGLARKCEVQVAYAIGVAHPVSILVTTFGTGKLPDERLAQLVRETFDLRPGAIIRDLDLRRPIYRQVAAYGHFGRPDLDLPWERTDKVDLLREKAGI

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.491 kDa

MATRLFTSESVTEGHPDKIADQVSDSILDAMLKDDPKSRVAVETMITTGQVHVAGEVTTKTYVDIASVVRERILEIGYDSSKKGFDGASCGVSVSIGSQSPDIAQGVDTAHEARVEGSTEDDLDRQGAGDQGLMFGFACDETPELMPLPIALAHRLARRLSAVRKDGQVGYLRPDGKTQVTIEYEDGKPVRLDTVVVSSQHAADIDLDTLLAPDVAEYVVEPELALLEISTEGRRLLVNPTGRFEIGGPMGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLASRCEVQVAYAIGKAHPVGLFVETFGTGKVPDAQIQDAVTQVFDLRPAAIVRDLDLLRPIYAQTAAYGHFGRPELDFTWEATSRADALTAAVKG

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.556 kDa

MAANRRLFTSESVTEGHPDKMSDQISDAILDEILKKDPNARVACETTVTTGLVLVSGEISTSTYVDIPALVRETVKEIGYTRAKYGFDFETCAVLTAIDEQSADIAGGVNQALEARQGKMSEEEIDAIGAGDQGLMFGYACDETEELMPLPISLAHQLSKRLADVRKEGIVDYLRPDGKTQVTVEYDENDKPERIDTIVISTQHHSEIQNEQIERDMIEKVIQAVVPSELLDDKTKYFINPTGRFVIGGPQGDVGLTGRKIIVDTYGGYARHGGGAFSGKDATKVDRSAAYAARYVAKNIVAAGLAKSCEVQLAYAIGVAQPVSIAVNTFGTGKVSEDRLVEAVRELFDLRPAGIIRMLDLRKPIYKNTAAYGHFGRKDILFPWEKTDKTEELIALTK

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.76 kDa

MTEQKGRYLFTSESVTEGHPDKMADQISDAVLDAILALDPRARVACETLLTTGLVVVTGEITTHAYVDIPNLVRDVVRDIGYTRAKYGFDGSTCGVMTAIDPQSPDIAQGVDVAIEVRGEVNEKELEIGAGDQGMMFGFACDETPELMPLPISLAHRLARRLAQVRKNGTLPYLRPDGKTQVTIEYEDGRPKRIDTIVISAQHDPDTTQEQIRKDVIDYVILDVVDRNLIDDRTRYFINPTGRFVVGGPQGDTGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSGAYAARWVAKNIVAAGLARKCEVQVAYAIGVAHPVSILVTTFGTGKLPDERLAQLVRETFDLRPGAIIRDLDLRRPIYRQVAAYGHFGRPDLDLPWERTDKVDLLREKAGI

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.696 kDa

MSNNRRLFTSESVTEGHPDKIADQISDAILDELLKKDPDARVACETVVTTGMAMIVGEISTATYVDFPKVVRDTVEEIGYTRAKYGYDSQTMAVMSAIDEQSPDIAQAVDRALEYRNEISEEEIEATGAGDQGLMFGFATNETDTYMPTPIYFSHQLAKRLSDVRKDGTLKYLRPDGKVQVTVEYDENDKPVRIDTIVISTQHAEDVTLDQIQEDIRKHVIDPIVPASLLDDETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGFARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEVQLAYAIGVAEPVSISIDTFGTGKVPESKLVEAVRDNFDLRPAGIIKMLDLKRPIYKQTAAYGHFGRTDVALPWERVDKVDVLKEAVQA

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.639 kDa

MTYNKRLFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTSTYVDIPKVVRETIKGIGYTRAKYGYDYQTMAVLTAIDEQSPDIAQGVDKALEYRNDISEEEIEATGAGDQGLMFGYATNETETYMPLPIFLSHQLAKRLSDVRKDGILNYLRPDGKVQVTVEYDESDKPKRIDTIVVSSQHADDIELEQIQSDIKEHVIYPTVPEGLIDNETKFFINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSISIDTFKTGKVSEAQLVEAVRANFDLRPAGIIKMLDLKHPIYKQTAAYGHFGRTDVLLPWEKLDKVNVLKDAVQA

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.911 kDa

MTYNKRLFTSESVTEGHPDKIADQVSDAILDEILKDDPNARVACETTVTTGMALISGEISTTTYVDIPKVVRETIKEIGYTRAKFGYDSQTMAVLTAIDEQSPDIAQGVDTALEYRDEASEAEIEATGAGDQGLMFGYATNETDTYMPLPIFLSHQLAKRLSDVRKDEILKYLRPDGKVQVTVEYDEQDKPVRIDTIVLSTQHAEDIELDQIKDDIKTHVIYPTVPESLLDEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAQLAEKCEVQLAYAIGVAEPVSISIDTFGTGKVSEYELVEAVRKHFDLRPAGIIKMLDLKHPIYKQTAAYGHFGRTDVLLPWEKLDKVNLLKDSVKA

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.335 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDENDQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRTDIDLPWERVDKVQALKDFIASK

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.334 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDENNQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRTDIDLPWERVDKVQALKDFIASK

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.335 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILEQDPDAHVAAETAVYTGSVHVFGEISTTAYVDINRVVRNTIAEIGYDKAEYGFSAESVGVHPSLVEQSPDIAQGVNEALEVRGSLEQDPLDLIGAGDQGLMFGFAVDETPELMPLPISLAHQLVKKLTDLRKSGELTYLRPDAKSQVTVEYDENDQPIRVDAVVISTQHDPNVTNDQLHKDVIEKVINEVIPSHYLDDQTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAADLAKKVEVQLAYAIGVAQPVSVRVDTFGTGVIAEADLEAAVRQIFDLRPAGIINMLDLKRPIYRQTAAYGHMGRTDIDLPWERVDKVQALKDFIASK

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.412 kDa

MRASYLFTSESVSEGHPDKVCDRISDEIVDLFYREGPKAGIDPWQIRAACETLATTNKVVIAGETRGPKSVTNEQIEGVVRAAIKDIGYEQEGFHWKTCDIEILLHPQSADIAQGVDALQPGEVKEEGAGDQGIMFGYATNETPDLMPAPIFYAHKILRLISEARHSGREKVLGPDSKSQVTVQYENGKPVGVREIVVSHQHLVPDLTSSQVRDIVEPYVREALPKDWITPKTIWHINPTGKFYIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADRCTLQLAYAIGVARPLSIYIDTHGTGKVPEEQLEKAAAQAMDLTPRGIRSHLDLNRPIYARTSAYGHFGRTPDNEGGFSWEKTDLVEQLKRAL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.207 kDa

MRASYLFTSESVSEGHPDKVCDRISDEVVDLFFREGPKAGIDPWAIRAACETLATTNKVVIAGETRGPASVTNDQIESVVRAAIKDIGYEQEGFHWDTCDIEILLHPQSADIAQGVDALQPGTNKEEGAGDQGIMFGYATNETPDLMPAPIFYAHKILRLISEARHSGKEKVLGPDSKSQVTIQYENGKPVGVREIVVSHQHLVEDMTSNQVRERVEPYVRQALPDGWITDKTIWHINPTGKFYIGGPDGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYASRYLAKNIVAAGLADRCTLQLAYAIGVARPLSIYIDTHGTGKVSEDKLEKAVAEAMDLTPRGIRSHLDLNKPIYARTSSYGHFGRTPDADGGFSWEKTDLADALKRAV

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.205 kDa

MRASYMFTSESVSEGHPDKVCDRISDEVVDLFFREGPKAGISPWAIRAACETLATTNKVVIAGETRGPASVTNDQIESVVRAAIKDIGYEQEGFHWETCDIEILLHPQSADIAQGVDALQPGTNQEEGAGDQGIMFGYATNETPDLMPAPIFYAHKILRLISEARHSGKEKVLGPDSKSQVTIQYENGKPVGVREIVVSHQHLVEDMTSAHVRERVEPYVRQALPADWITDKTIWHINPTGKFYIGGPDGDTGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYASRYLAKNIVAAGLADRCTLQLAYAIGVARPLSIYIDTHGTGKVSEDKLEKAVAEAMDLTPRGIRTHLDLNKPIYARTSSYGHFGRTPDADGGFSWEKTDLADALKRAV

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.502 kDa

MLYICNKRRLFMSNYLFTSESVSEGHPDKVADQISDAILDAILEQDPQARVACETLVTTGMALIAGEITTSAWVDMPEVVRNTIKEIGYNSSEMGFDWQSCAVMTTIDKQSPDIAQGVNEGAGIDLDQGAGDQGLMFGYASNETDVLMPMPITLAHRLTRRQAQVRKSSILPWLRPDAKSQVTIEYENKIPKRIDAVVLSTQHDESISYNDLKEAVMEEIIKPTLPADMIDANTKFFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGKALHGGGAFSGKDPSKVDRSSAYYGRYVAKNLVAAGIASELQIQVAYAIGIAQPVSINVNSFGTGRISDAAIKELILGNFDLRPKAIVQQLDLLRPIYRQTAAYGHFGRSDVEFPWERTDKIEELKSAAGL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.117 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.283 kDa

MRGSYLFTSESVSEGHPDKVCDRISDEIVDLFFSEGPKAGVDPWAIRAACETLATTNKVVIAGETRGPESVTKEKIESVVRAAIKDIGYEQDGFHWKTADIDILLHPQSADIAQGVDALQPGANKEEGAGDQGIMFGYACNETPDLMPAPIFYAHKILRLISEARHSGKEKVLGPDSKSQVTVQYENGKPVGVREIVVSHQHLIEDMSSDQVRERVEPYVREALPKAWVTDKTIWHINPTGKFFIGGPDGDAGLTGRKIIVDTYGGAAPHGGGAFSGKDPTKVDRSAAYAARYLAKNIVAAGLADRCTLQLAYAIGVARPLSIYIDTHGTGKAPEDTLERIVSEAMDLTPRGIRKHLDLNRPIYARTSSYGHFGRTPDNEGGFSWEKTDLAEVLKRAV

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.179 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEAFESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLVTKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.098 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWEHLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.116 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNNQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.117 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.117 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.117 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.078 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQICQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKIDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.161 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKDVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.117 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.144 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTKAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

398 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.098 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEISTTAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEALESREGDTDDLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVTVEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAAGLATKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKRPIYKQTAAYGHMGRTDIDLPWEHLNKVDALVEAVKTVL

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.84 kDa

MADLRLFTSESVTEGHPDKICDQISDSILDALLAVDEHSRVAVETLVTTGLVHVAGEVTTKGYVEIPALVRDTIVEIGYDSSDVSFDGTQCGVSVSIGAQSPDIAQGVDNALETRSERSQDDLDRQGAGDQGIMFGFATTETPQYMPLPIWLAHRLAERLAAVRKDGTLGYLRPDGKTQVTIGYEGYVPKSVQTVVLSTQHARDIPSQQLRADVIEQVIEPVMHAAGVETSHIRTLINPTGRFEIGGPKGDAGLTGRKIIVDTYGGASRHGGGAFSGKDPSKVDRSAAYALRWVAKNAVAAGLADRLEVQIAYAIGKAAPVGLYVETFGTAHVPDERIIHAIREVFDLRPAAIARDLDLLRPIYARTATYGHFGRELPDFTWERLDRVDDLRSAAGL

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.386 kDa

MARKLFTSESVTEGHPDKICDQISDAVLDAIFSQDPMARVACETAVTTGLVLVTGEITTNCYVDIPKIVRSTIREIGYDRAKYGFDCDTCAVLTSIDEQSPDIAMGVNKALEAKTGEMSDEEIEAIGAGDQGMMFGFACDETPELMPMPISLAHKLAMRLSQVRKNGTLNYLRPDGKSQVTVEYDGDKPVRVDTVLISTQHGPEVDYDTIKRDVIEHVIKPVIPAELLDSKTKYLVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLARKCEVQLAYAIGVARPVSVRVDTFGTGIIPEEKIESLVNKYFDLRPAGIIKTLDLRRPIYKQTAAYGHFGRTDIDLPWERTDKAEELRKEAQSL

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.627 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHADDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.591 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGIARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.641 kDa

MLNNKRLFTSESVTEGHPDKIADQVSDAILDAILKDDPNARVACETTVTTGMALIAGEISTTTYVDIPKVVRETIKEIGYTRAKYGYDYETMAILTAIDEQSPDIAQGVDKALEYRDKDSEEEIEATGAGDQGLMFGYATNETETYMPLAIYLSHQLAKRLSDVRKDGTLNYLRPDGKVQVTVEYDENDNPVRIDTIVVSTQHAEDVTLEQIQEDIKAHVIYPTVPENLINEQTKFYINPTGRFVIGGPQGDAGLTGRKIIVDTYGGYARHGGGCFSGKDPTKVDRSAAYAARYVAKNIVAAGLADQCEVQLAYAIGVAEPVSIAIDTFGTGKVSEGQLVEAVRKHFDLRPAGIIKMLDLKQPIYKQTAAYGHFGRTDVLFPWEKLDKVEELKDAVK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.911 kDa

MSRKLFTSESVTEGHPDKVADQISDAILDSILAKDPMARVACETFVTTGLVLVGGEISCQCYVDIPKVVRETILEIGYTRAKYGFDGDTCAVLTAIDEQSPDIAMGVDKALEAKTGETTEAEIEAIGAGDQGMMFGYATDETPELMPLPISLAHTMARRLSEVRKTGIVDYLRPDGKTQVTVEYDGDKPSRIDTVVISTQHHPEVDLETIRKDMIEKVALHVLPAELVDDKTRFLINPTGRFVIGGPHGDAGLTGRKIIVDTYGGSARHGGGAFSGKDPTKVDRSAAYAARYVAKNVVAAGLAKRCEVQLAYAIGVAHPVSVRVQTFGTGAVSDEVIIDLINRHFDLRPAGIIKSLELRRPIYKQTAAYGHFGRPDLDLPWECTDKADALRAEAGLK

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

43.53 kDa

MARHLFTSESVTEGHPDKICDQISDSILDALLEKDPQSRVACETTVTTGLVLVAGEISTSAYVDIPKLVRETVREIGYTRAKYGFDCDTCAVITSIDEQSGDIAMGVDEGLESKTGEEIEEEIEKVGAGDQGIMFGFACNETPELMPLPISLAHKLSRRLTEVRKTGLVDYLRPDGKTQVTVEYEGSKAVRVHTVLISAQHCETVSNDKIREDLINHVIKEVIPAELLDEETKIYINPTGRFVIGGPQGDTGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSAAYAARYVAKNIVAAGLADKCEIELAYAIGIARPLSIFIDTFGTGKVSEEKLVELVNKHFDLRPGAIIRDLDLRKPLYKKVAAYGHFGRTDIDLPWERTDKVEQLRKDALGE

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.

42.965 kDa

MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPDAHVAAETAVYTGSVHIFGEVSTTAYVDINRVVRDTIAEIGYNNAEYGFAAESVGVHPSLIEQSPDIAQGVNESLEVRGTGDQDSLDLIGAGDQGLMFGFAIDETPEFMPLPVSLSHKLVKKLADLRKSGEISYLRPDAKSQVTVEYDENDQPVRVDTVVISTQHDPEATNDQIRHDVIEKVIKAVIPAEYLDEDTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLARKAEVQLAYAIGVANPVSVRVDTFGTATVAERKLESAVRDLFDLRPAGIIQMLDLKRPIYRQTAAYGHMGRTDVDLPWEKLDKVDALKAAVEA

metK

S-adenosylmethionine synthase

397 amino acids

Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet formation and the subsequent tripolyphosphate hydrolysis which occurs prior to release of AdoMet from the enzyme.

Belongs to the AdoMet synthase family.