About Services Proteins Contact

malR

Gene
malR
Protein
HTH-type transcriptional regulator MalR
Organism
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Length
344 amino acids
Function
Transcriptional repressor of the maltosaccharide utilization operon malEFG.
Mass
36.351 kDa
Sequence
MTTRLADIAAQAGVSEATVSRVLNGKPGVAATTRQSVLAALDVLGYERPVRLRQRSEGLVGLITPELENPIFPALAQVIGQALTRQGYTPVLATQTPGGSTEDELTEMLVDRGVAGIIYVSGLHADTTADMQRYERLRAQGVPFVLVDGFSSQVQAPFISPDDRAAMSLAVTHLVSLGHTRIGLALGPKRFVPVQRKIEGFVRTVQDQLGLSAETVEKELVQHSLYTLEGGQAAASALIGRDCTAVVCASDMMALGAIRAARQLGLDVPKDVSVVGFDDSPLIAFTDPPLTTVRKPVPAMGQAAVRTLLEEIGGTPAPHSEFVFMPELVVRGSTASAPGERGRP

Gene
malR
Protein
HTH-type transcriptional regulator MalR
Organism
Staphylococcus xylosus
Length
337 amino acids
Function
Transcriptional repressor of the malA gene for maltase.
Mass
37.691 kDa
Sequence
MVTIKDIAQAANVSTSTVSRVISGNPRISMQTREKVKATMKSFNYQPNRAARTLATKQSNTIGIIQKSASIEDSQNPFVLDVLSGIFSKCKNHGYATISTTKGQSIEIELEVQEMIHYHSVDGFIVLYSKKSDPIIDILKSHAMPYVIIGKPLTDDDIIHIDNDNVSASQSLTRYLIDKGHNKFLFVAETGNYEVVKDRIAGHLNAIEQTDSVTDIVYFAKNRHYIRSFFQDLIEHRTLPTVVITSDTLLNHLILSVFYELKLHIPTDIQTATFNDSYLNAFASPPQTTVDIYPKLLGEGAAESAINIIQGHNILNFYKLIPTTIIERESTTTIQEV

Gene
malR
Protein
HTH-type transcriptional regulator MalR
Organism
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Length
328 amino acids
Function
Transcriptional repressor of the maltosaccharide utilization operons malxCD and malMP.
Mass
37.044 kDa
Sequence
MPVTIKDVAKAAGVSPSTVTRVIQNKSTISDETKKRVRKAMKELNYHPNLNARSLVSSYTQVIGLVLPDDSDAFYQNPFFPSVLRGISQVASENHYAIQIATGKDEKERLNAISQMVYGKRVDGLIFLYAQEEDPLVKLVAEEQFPFLILGKSLSPFIPLVDNDNVQAGFDATEYFIKKGCKRIAFIGGSKKLFVTKDRLTGYEQALKHYKLTTDNNRIYFADEFLEEKGYKFSKRLFKHDPQIDAIITTDSLLAEGVCNYIAKHQLDVPVLSFDSVNPKLNLAAYVDINSLELGRVSLETILQIINDNKNNKQICYRQLIAHKIIEK

Gene
malR
Protein
HTH-type transcriptional regulator MalR
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Length
328 amino acids
Function
Transcriptional repressor of the maltosaccharide utilization operons malxCD and malMP.
Mass
37.044 kDa
Sequence
MPVTIKDVAKAAGVSPSTVTRVIQNKSTISDETKKRVRKAMKELNYHPNLNARSLVSSYTQVIGLVLPDDSDAFYQNPFFPSVLRGISQVASENHYAIQIATGKDEKERLNAISQMVYGKRVDGLIFLYAQEEDPLVKLVAEEQFPFLILGKSLSPFIPLVDNDNVQAGFDATEYFIKKGCKRIAFIGGSKKLFVTKDRLTGYEQALKHYKLTTDNNRIYFADEFLEEKGYKFSKRLFKHDPQIDAIITTDSLLAEGVCNYIAKHQLDVPVLSFDSVNPKLNLAAYVDINSLELGRVSLETILQIINDNKNNKQICYRQLIAHKIIEK

Gene
malR
Protein
Transcriptional regulatory protein MalR
Organism
Bacillus subtilis (strain 168)
Length
235 amino acids
Function
Member of a two-component regulatory system MalK/MalR. Activates transcription of maeA, maeN and yflS in presence of malate by binding to their promoter region.
Mass
26.965 kDa
Sequence
MINVLIVEDDPMVGELNKRYLSQIDGFQLKGIASSFQSALHILGEHHIDLILLDIYMPGKNGLELLTELRAQNEAVDVIVISAASELDVIKKTLRYGAVDYLIKPFEFERFQTALSDYRRKQKVYSTHRNMSQKELDAELFQKKEATEKVQLPKGLTKSTLKLIWSSIQSFENESFTTEDLAKHTEISQVSIRKYLKFLEDIQVLNVEMAYGTIGRPVFQYNVNNSNINGIKQYL

Gene
malR
Protein
Putative regulatory protein MalR
Organism
Fusobacterium mortiferum
Length
106 amino acids
Function
Potential regulator of the malBH genes.
Mass
12.501 kDa
Sequence
MIDLERKNKYKCSIEYTLSFMGGKWKPIILWHLGTEGIHRYGELKRKLDGITHKMLAQQLKELADDNLIIRKEYPQVPPKVEYSITEKGMGLMEILNLMHKWGQEN