About Services Proteins Contact

lysE

Gene
lysE
Protein
Lysine exporter protein
Organism
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Length
233 amino acids
Function
Involved in the efflux of excess of L-lysine. This is necessary to control the intracellular L-lysine level.
Similarity
Belongs to the LysE/ArgO transporter (TC 2.A.75) family.
Mass
25.082 kDa
Sequence
MEIFITGLLLGASLLLSIGPQNVLVIKQGIKREGLIAVLLVCLISDVFLFIAGTLGVDLLSNAAPIVLDIMRWGGIAYLLWFAVMAAKDAMTNKVEAPQIIEETEPTVPDDTPLGGSAVATDTRNRVRVEVSVDKQRVWVKPMLMAIVLTWLNPNAYLDAFVFIGGVGAQYGDTGRWIFAAGAFAASLIWFPLVGFGAAALSRPLSSPKVWRWINVVVAVVMTALAIKLMLMG

Gene
lysE
Protein
Lysine exporter protein
Organism
Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Length
228 amino acids
Function
Involved in the efflux of excess of L-lysine. This is necessary to control the intracellular L-lysine level (By similarity).
Similarity
Belongs to the LysE/ArgO transporter (TC 2.A.75) family.
Mass
24.662 kDa
Sequence
MSIAIAGFLMGLSLIVAIGPQNALIIRQGIKREGLIPILVVCILSDVILIFGGTAGVGALVDRAPIALVVLKWLGVAYLLYFGFTCFKEAFKRHGQALAVEQSEPVAYEPVADASSGVITKTRTKAQPKSAQRTWVKPVLAALAFTWLNPAAYIDVLVMLGGIANQHGPDGRWVFALGALCASLTWFPFIGYTSTRFSTVLSRPAVWRYINIAIGIIMMIMCARLIMH

Gene
lysE
Protein
Lysine exporter protein
Organism
Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Length
228 amino acids
Function
Involved in the efflux of excess of L-lysine. This is necessary to control the intracellular L-lysine level (By similarity).
Similarity
Belongs to the LysE/ArgO transporter (TC 2.A.75) family.
Mass
24.374 kDa
Sequence
MEIFVTGLLLGASLLLAIGPQNVLVIKQGIKREGITAVIIVCLLSDVVLFTLGTLGVGLISDTAPIILDILRWCGIAYLLWFAVMAARDALRARTEVTFVEHSEPVAAASASGGGVTTKQRPRLRITSGTRQVWVRPMLMAIVLTWLNPNAYLDAFVFIGGVGAQYGETGRWIFAAGAFAASLVWFPLVGYGAAALSRPLSSPRVWRWINIGVAVVLTGLAVKLILMG

Gene
LysE
Protein
Lysozyme E
Organism
Drosophila melanogaster
Length
140 amino acids
Function
Unlikely to play an active role in the humoral immune defense. May have a function in the digestion of bacteria in the food.
Similarity
Belongs to the glycosyl hydrolase 22 family.
Mass
15.553 kDa
Sequence
MKAFIVLVALAMAAPALGRTLDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDGCF