luxU

Phosphorelay protein LuxU

115 amino acids

Phosphorelay protein which receives a sensory signal from a sensor kinase and transmit it to LuxO. At low cell density, a phosphoryl group is transferred from the sensor kinase, probably on His-56 and this phosphoryl group is further transferred to LuxO.

12.752 kDa

MELLNQKKIASLTEEIGADNVPVLLEIFLSELESYLKVLCDATYSDKLVYLKDISHALKSSAASFGADALCHFAVEIDTRAKEGDALDETQDVVAMIDRLHQTQQAYLSWQANGF

luxU

Phosphorelay protein LuxU

115 amino acids

Phosphorelay protein which receives a sensory signal from a sensor kinase and transmit it to LuxO. At low cell density, a phosphoryl group is transferred from the sensor kinase, probably on His-56 and this phosphoryl group is further transferred to LuxO.

12.752 kDa

MELLNQKKIASLTEEIGADNVPVLLEIFLSELESYLKVLCDATYSDKLVYLKDISHALKSSAASFGADALCHFAVEIDTRAKEGDALDETQDVVAMIDRLHQTQQAYLSWQANGF

luxU

Phosphorelay protein LuxU

114 amino acids

Phosphorelay protein which receives sensory signals from LuxN and LuxP and transmits them to LuxO, at low cell density. LuxN and LuxP transfer a phosphoryl group to LuxU on His-58 and this phosphoryl group is further transferred to LuxO. At high cell density, as LuxU could function to establish an equilibrium between the aspartyl-phosphate of LuxN and the aspartyl-phosphate of LuxO, LuxU transfers phosphate from LuxO to LuxN (and probably LuxP) and finally phosphate is drained from the system.

12.689 kDa

MNTDVLNQQKIEELSAEIGSDNVPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAASFGADRLCERAIAIDKKAKANQLQEQGMETSEMLALLHITRDAYRSWTN

luxU

Phosphorelay protein LuxU

114 amino acids

Phosphorelay protein which receives sensory signals from LuxN and LuxP and transmits them to LuxO, at low cell density. LuxN and LuxP transfer a phosphoryl group to LuxU on His-58 and this phosphoryl group is further transferred to LuxO. At high cell density, as LuxU could function to establish an equilibrium between the aspartyl-phosphate of LuxN and the aspartyl-phosphate of LuxO, LuxU transfers phosphate from LuxO to LuxN (and probably LuxP) and finally phosphate is drained from the system.

12.689 kDa

MNTDVLNQQKIEELSAEIGSDNVPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAASFGADRLCERAIAIDKKAKANQLQEQGMETSEMLALLHITRDAYRSWTN

luxU

Phosphorelay protein LuxU

114 amino acids

Phosphorelay protein which receives sensory signals from LuxN and LuxP and transmits them to LuxO, at low cell density. LuxN and LuxP transfer a phosphoryl group to LuxU on His-58 and this phosphoryl group is further transferred to LuxO. At high cell density, as LuxU could function to establish an equilibrium between the aspartyl-phosphate of LuxN and the aspartyl-phosphate of LuxO, LuxU transfers phosphate from LuxO to LuxN (and probably LuxP) and finally phosphate is drained from the system.

12.689 kDa

MNTDVLNQQKIEELSAEIGSDNVPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAASFGADRLCERAIAIDKKAKANQLQEQGMETSEMLALLHITRDAYRSWTN

luxU

Phosphorelay protein LuxU

113 amino acids

Phosphorelay protein which receives sensory signals from a sensory kinase and transmit them to LuxO. At low cell density, a phosphoryl group is transferred from the sensory kinase, probably on His-57 and this phosphoryl group is further transferred to LuxO.

12.679 kDa

MREWINQSKIDLLAKEIGEENVPILVNIFLGELNDYQSKLVSDTVADKLGYLKEISHALKSSAASFGADRLCAKAVELDSRAKSGEMMDISLEVEHMLELLKQTHQCYSDLVH

luxU

Phosphorelay protein LuxU

112 amino acids

Phosphorelay protein which receives a sensory signal from a sensor kinase and transmit it to LuxO. At low cell density, a phosphoryl group is transferred from the sensor kinase, probably on His-56 and this phosphoryl group is further transferred to LuxO.

12.519 kDa

MTILNQQKIDELSIEIGSDNVPVLLDIFLGEMDTYIDNLSQLEGSERLMYLKEISHALKSSAASFGADSLCELAMSIDKKAKSGELVEQGSEVNTMLDRLNETRDAYRSWTQ