lipA

Capsule polysaccharide modification protein LipA

704 amino acids

Involved in the phospholipid modification of the capsular polysaccharide, a strong requirement for its translocation to the cell surface.

79.566 kDa

MFLFSDGLQSINNNNRRKRIVKNAYIPSRGIRKIPHLSTLLPEFHIYKDGKGAEAVVGWGLRPTTHKARAFATEHQLPFIALEDGFLRSLGLGVSGYPPYSIVYDDIGIYYDTTRPSRLEQLILAADTMPSETLAQARQAMDFILQHHLSKYNHAPELSDDHPLRSPSKSETVLIIDQTFGDMAIQYGGADASTFELMFQTALNENPQADIWVKTHPDVLCGKKQGYLTQLVQQHRVHLLAEDINPISLLQNVDKVYCVTSQMGFEALLCGKPLTTFGLPWYAGWGVSDDRHPKIGSLIQTQRRAPRNLLQLFAAAYLQYSRYLNPNTGEAGSLFDVIDYLATVKRKNDKLRGELYCVGMSLWKRAVAKPFFNVPSCRLKFISSTQKLARVKLSDDARILAWGNGKEAIVRFAEQHHIPLLRMEDGFIRSVGLGSNLVPPLSLVTDDMSIYFNAETPSRLEYILQNQNFDDQDFQTALKLQKMLTENHISKYNVGSSDFTAPSTDKTVILVPGQVEDDASIRYGSPQIYRNLDLLRTVRERNPNAYIIYKPHPDVVSGNRIGHISPDDAARYADQTAEQADILTCLQYADEIHTMTSLTGFEALLRGKKVSCYGLPFYAGWGLTQDLLPIPRRSRRLELWQLVAGTLIYYPDYIHPKTHQAINAETAAQILIRQKNMQKNNNGLHRGCFAKKLGKIKQLYRSFK

lipA

Capsule polysaccharide modification protein LipA

704 amino acids

Involved in the phospholipid modification of the capsular polysaccharide, a strong requirement for its translocation to the cell surface.

79.606 kDa

MFLFSDGLQSINNNNRRKRIVKNAYIPSRGIRKIPHLSTLLPEFHICKDGKEAEAVVGWGLRPTTHKARAFAAEHQLPFIALEDGFLRSLGLGVAGYPPYSIVYDDIGIYYDTTRPSRLEQLILAADTMPSETLAQAQQAMDFILQHHLSKYNHAPELSDDHPLRSPSKPETVLIIDQTFGDMAIQYGGADASTFELMFQTALNENPQADIWVKTHPDVLCGKKQGYLTQLAQQHRVHLLAEDINPISLLQNVDKVYCVTSQMGFEALLCGKPLTTFGLPWYAGWGVSDDRHPEINRLVQTQRRATRNLLQLFAAAYLQYSRYLNPNTGEAGSLFDVIDYLATVKRKNDKLRGELYCVGMSLWKRAVAKPFFNVPSCRLKFISSTQKLARVKLSDDARILAWGNGKEAIVRFAEQHHIPLLRMEDGFIRSVGLGSNLVPPLSLVTDDMSIYFNAETPSRLEYILQNQNFDDQDFQTALKLQKMLTENHISKYNVGSSDFTAPSTDKTVILVPGQVEDDASIRYGSPQIYRNLDLLRTVRERNPNAYIIYKPHPDVVSGNRIGHISPEDAARYADQTAEQADILTCLQYADEIHTMTSLTGFEALLRGKKVSCYGLPFYAGWGLTQDLLPIPRRSRRLELWQLIAGTLIHYPDYIHPETHQAINAETAAQILIRQKNMQKNNNGLHRGCFAKKLGKIKQLYRSFK

lipA

Lipase 1

680 amino acids

Belongs to the AB hydrolase superfamily. Lipase family.

76.675 kDa

MKSQNKYSIRKFSVGASSILIATLLFLSGGQAQAAEKQVNMGNSQEDTVTAQSIGDQQTRENANYQRENGVDEQQHTENLTKNLHNDKTISEENHRKTDDLNKDQLKDDKKSSLNNKNIQRDTTKNNNANPSDVNQGLEQAINDGKQSKVASQQQSKEADNSQDSNANNNLPSQSRIKEAPSLNKLDQTSQREIVNETEIEKVQPQQNNQANDKITNYNFNNEQEVKPQKDEKTLSVSDLKNNQKSPVEPTKDNDKKNGLNLLKSSAVATLPNKGTKELTAKAKDDQTNKVAKQGQYKNQDPIVLVHGFNGFTDDINPSVLAHYWGGNKMNIRQDLEENGYKAYEASISAFGSNYDRAVELYYYIKGGRVDYGAAHAAKYGHERYGKTYEGIYKDWKPGQKVHLVGHSMGGQTIRQLEELLRNGNREEIEYQKKHGGEISPLFKGNHDNMISSITTLGTPHNGTHASDLAGNEALVRQIVFDIGKMFGNKNSRVDFGLAQWGLKQKPNESYIDYVKRVKQSNLWKSKDNGFYDLTREGATDLNRKTSLNPNIVYKTYTGEATHKALNSDRQKADLNMFFPFVITGNLIGKATEKEWRENDGLVSVISSQHPFNQAYTKATDKIQKGIWQVTPTKHDWDHVDFVGQDSSDTVRTREELQDFWHHLADDLVKTEKLTDTKQA

lipA

Lipoprotein A

578 amino acids

Belongs to the M.pulmonis LipAB lipoprotein family.

66.219 kDa

MNKKYFKKYSWVLILSTSILAPMTLASCNHNVAKKEDKTQNDSSNLSNKTNKSDPNDHLKDKDKNVSQDNKDSTNKAVSNENSQTQSQKTNESSQNTKDDSSKTSNLITNQNSSSNTKSKIQENKQSQKDQNTSAVNVSALEKQTKNDENISLVNSKDTNVILKNDEKVALAKDDSKEKSKNSSNLNLKTPVENRQNKNEVKDDKKALQWWQKLNESASILESFSYDQTSLSLTFKEGMPLGLEVVLKLENLDSHEEKEISFKTTNGKVQNVLLTSSNLTSGKWKIKSFSFDKTYSHSPTIETTFDFKTNEKLKQERIEKIQKAIDKYQIKIKQNYKDKPLISKYALSNFDLNLNFKDLEIVNNSLKFDGSNLNQDLKSEKQMKITFEKVSENQANKTRKAHFKITTLDNLVFEKTLEWSYKTNKEYLDEFKNGSALWDDLQASLTSVFEKSLWHPYQLPKAKSKINTINLINDVSASFQGYDYLDDFNGSAKLKFKLQRGQEQRDITFTINGFLKVSLIDPLYKGNLRNSEFDVKASSNGYWLGQYYTAAEVFKHYSNGKSYWYATANDGNPWLEFS

lipA

Lipoyl synthase, apicoplast

543 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

58.706 kDa

MAYFFDFPTDTWVEDASPGGPPKRAFGHGLAAGSSHFASPVSRRRLPTITALLLFSLLSASQSGALSVSQCSRRVSLGPLLSRVSSVSCTPSAAASALASSLYPTDSLSSVEGSVAPRPPPSSLAFVLRRVPPAAYSSSLSPSVLRFKHSLPRPLQGSLVCAPGILGGAAGSARFAGCCGSQGRSCGSGKNPELPLKGSKDEVIPRVGTSTAGPRPDWFHVPAPQAASRGAEESRYQQLQKQIRGLDLHTVCEEAKCPNIGECWNGGTATLILLGDTCTRGCRFCAIKTSSKPPPPDPLEPEKVADAVAKWDIDYVVMTSVDRDDMPDGGAGHFARTVQLVKKAKPSMLIECLVSDFQGMEESVRTLAQSGLDVYAHNIETVRRLTPYVRDKRAKYDQSLRVLHLAKQFNPSLFTKSSIMLGLGETSEEVVRTLRDLRDHDVDVVTLGQYLRPTKQQLGVVEYVTPETFKKYQDIAEEMGFKYVASGPLVRSSYKAGEYYMKHLIDDARKHGRRETVKQVKLEADVGTLKGTTTTFQVNEKEA

lipA

Lipoyl synthase, apicoplast

502 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

57.463 kDa

MNFLVLFFSYSIFVLPYSILVYGISKDRKCCEYGNSVDSSKILYIAGSVRKRRKTFEKKINVSNFEREGNANGYKHIDNKGIYATKQNLEFDEARNKEANENNKNDATTVNRKIIIESENKNNHNNQEQNIKDCYTNENAQNDEKNKKVKIPKVGNAMPEKKPDWFHVPAPNGEKYKKLKSDLGKLKLHTVCEEAQCPNIGECWNIGTATIMLLGDTCTRGCKFCSIKTSSKPPPPDINEPFNTAKAICEWDINYIVITSVDRDDLPDGGADHFAKTVELIKFSKPSILIECLVSDFQGNIDSIKRLALSGLDVYAHNIETVKRLQKYVRDKRANYEQSLYVLKKAKEINPNLYTKTSIMLGLGETQDEVLQTMKDARSNDIDVITFGQYLRPTKNHLNVVEYISPQMFNYYKDVGLKMGFKYIASGPLVRSSYMAGEYFMKNMVEKGRNQKNQQIKPVELKLVTELDKLTECIQKEIKHREISVFIQVHAFLVNVFVLVRA

lipA

Lipoyl synthase, apicoplast

442 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

50.641 kDa

MRVLTPSLYIYAFFIFCVRFKCGNRTTVASAIRASYDMPPKELRVGDMLKKTSQPNCNYRTRGKCRKFFFVWKLDKMRDAHLGVQAKRRKNHLRSGSATYEASLGEHQLKGKRKESATNVEKEKKEKEQQEERLPVPKVGNKMPEKKPDWFHVPAPTGKKYNKLKEDLKKLKLHTVCEEAQCPNIGECWNIGTATIMLLGDTCTRGCKFCSIKTSSKPLAPDANEPFNTAKAICEWDINYVVLTSVDRDDLPDGGASHFAKTIELIKFSRPEILIECLVSDFQGNVDSIRKLANSGMEVYAHNIETVRRLQKFVRDRRANYEQSLRVLKIAKEINPMLYTKTSIMLGLGETKEEVLEAMSDVRQHNIDVITFGQYLRPTKNHLNVVEYVSPQMFDFYKEEGMKMGFKYIASGPLVRSSYKAGEYFMKSLVEQRRGAKTHAQG

lipA

Lipoyl synthase, apicoplast

442 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

50.317 kDa

MHVLTPSLYIYAFFIVCVRLKCGRSKRVANAKHATYDMPPKGLRVRDMLEKTAQQNCNQRKRGKCRKFFFLWKMDKMGDTHLGGQANGRKNLLRSESATDEASLGGNPLKEKLKESPANWGKDKQEEQQSTDRLPLPKVGNKMPEKKPDWFHVPAPTGKKYNELKADLKKLKLHTVCEEAQCPNIGECWNIGTATIMLLGDTCTRGCKFCSIKTSSKPLPPDANEPFNTAKAICEWDINYVVLTSVDRDDLPDGGASHFAKTIELIKFSRPEILIECLVSDFQGNVDSIRKLANSGMEVYAHNIETVRRLQKFVRDRRANYEQSLWVLKTAKEINPLLYTKTSIMLGLGETKQEVLQAMADVRQNNIDVITFGQYLRPTKNHLNVVEYVSPQMFDYYKEEGMKMGFKYIASGPLVRSSYKAGEYFMKNLVEQRRGVKLHAEG

lipA

Lipase A

416 amino acids

Lipolytic enzyme that possesses both lipase and acetylxylan esterase activity. Active towards p-nitrophenol esters of various carbon chain length with preference for medium-chain fatty acids (C-8). Also highly active on the acetylated compounds xylose tetra-acetate and oat spelt xylan.

Belongs to the AB hydrolase superfamily. Lipase family.

45.645 kDa

MRLAPQKPLLLSTVLHLLLSIWMLGFASLAGATVQEPLAASDTPKPVSAALFSSIERLSRLVDITYCVGNTGVWKPFACASRCNEFPTLTLERTWRTGILMSDSCGLIAVDHGTPRHDAGEGKDDPLAEKAIIVAFRGTYSLTNTIIDLSTIPQEYVPYPSPDDGGNEPPREPSHRCDNCTVHSGFLASWRHARKVVLPELKVLRQKYPEYPIRLVGHSLGGAVAMLAALEMRVSLGWRDTVVTTFGEPRVGNRQLCDYLNAVFELNLGDEMDPAEREYRRVTHADDPVPLLPPAEWGYSSHGGEFFISKKDLPPSVEDVLVCHGDHDENCIARGKSSAVSVPAGDYDDALSTLEEQDVMLADALPWIPARLKLWELFFAHRDYFWRLGLCVPGGDPANWGRKGGEGAAESISAEG

lipA

Lipase A

416 amino acids

Lipolytic enzyme that possesses both lipase and acetylxylan esterase activity. Active towards p-nitrophenol esters of various carbon chain length with preference for medium-chain fatty acids (C-8). Also highly active on the acetylated compounds xylose tetra-acetate and oat spelt xylan.

Belongs to the AB hydrolase superfamily. Lipase family.

45.645 kDa

MRLAPQKPLLLSTVLHLLLSIWMLGFASLAGATVQEPLAASDTPKPVSAALFSSIERLSRLVDITYCVGNTGVWKPFACASRCNEFPTLTLERTWRTGILMSDSCGLIAVDHGTPRHDAGEGKDDPLAEKAIIVAFRGTYSLTNTIIDLSTIPQEYVPYPSPDDGGNEPPREPSHRCDNCTVHSGFLASWRHARKVVLPELKVLRQKYPEYPIRLVGHSLGGAVAMLAALEMRVSLGWRDTVVTTFGEPRVGNRQLCDYLNAVFELNLGDEMDPAEREYRRVTHADDPVPLLPPAEWGYSSHGGEFFISKKDLPPSVEDVLVCHGDHDENCIARGKSSAVSVPAGDYDDALSTLEEQDVMLADALPWIPARLKLWELFFAHRDYFWRLGLCVPGGDPANWGRKGGEGAAESISAEG

lipA

Lipoyl synthase, apicoplast

415 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

47.593 kDa

MHFGIPSLFYLYILFSIIMRIKCVITKNLKKTKKRTCSYIPHGNMEKGIILNYIEKPNPAYLKRGKNKNKNKNKKGDIYKLRNVEILLYANRYVHEGNENFSSTTKKLLLTPKVGNKMPEGKKPDWFHVAAPTVAKYNKLKDDIKKLNLHTVCEEAQCPNIGECWNIGTATIMLLGDTCTRGCKFCSIKTSSNPLPPDINEPFNTAKAICEWNIDYVVLTSVDRDDLPDGGASHFAKTVELVKFSRPDILIECLVSDFQGNIDSVRKLAFSGLDVYAHNIETVKRLQKYVRDKRANYDQSLFVLKTAKEINPQLYTKTSIMLGLGETKEEVIQTMYDARKNNIDVITFGQYLRPTKNHLSIVQYISPQMFEYYKEEGLKMGFKYIASGPLVRSSYKAGEYFIKNLVNQRNKDKKN

LIPA

Lysosomal acid lipase/cholesteryl ester hydrolase

399 amino acids

Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation.

Belongs to the AB hydrolase superfamily. Lipase family.

45.419 kDa

MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

LIPA

Lysosomal acid lipase/cholesteryl ester hydrolase

399 amino acids

Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation (By similarity).

Belongs to the AB hydrolase superfamily. Lipase family.

45.48 kDa

MKMRFLGLVVCLVLWTLHSEASGGKLTAVNPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALAPVVSVDFCTSPMAKLGRLPDLLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDINILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMKKYQ

Lipa

Lysosomal acid lipase/cholesteryl ester hydrolase

397 amino acids

Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation (By similarity).

Belongs to the AB hydrolase superfamily. Lipase family.

45.325 kDa

MQLQGLVFVFTIGILLSRVPTGTVSAVDPEVNMNVTEIIMRWGYPGEEHSVLTGDGYILSIHRIPRGRKNHFGKGPRPVVYLQHGLLADSSNWVTNIDNSSLGFLLADAGFDVWMGNSRGNTWSLKHKTLSVSQDEFWAFSFDEMAKYDLPASINYILNKTGQEQIYYVGHSQGCTIGFIAFSQMPELAKKIKMFLVLAPVLSLNFASGPLLQLGRLPDPLLKDMFGQKQFLPQSAMLKWLSIHVCTHVIMKELCANVFFLLCGFNEKNLNMSRVDVYTTHCPAGTSVQNMLHWGQVFKYRKLQAFDWGSSEKNYFHYNQSFPPSYNIKNMRLPTALWSGGRDWLADINDITILLTQIPKLVYHKNIPEWDHLDFIWGLDAPWKLYDEIISLMKKYQ

Lipa

Lysosomal acid lipase/cholesteryl ester hydrolase

397 amino acids

Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation (By similarity).

Belongs to the AB hydrolase superfamily. Lipase family.

45.186 kDa

MQLLGRVICFVVGILLSGGPTGTISAVDPEANMNVTEIIMHWGYPEHSVQTGDGYILGVHRIPHGRKNQFDKGPKPVVYLQWRHGFLADSSNWVTNIDNNSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEYWAFSFDEMAKYDLPASINYILNKTGQEQLYNVGHSQGCTIGFIAFSQMPELAKKVKMFFALAPVLSLNFASGPMVKLGRLPDLLLEDLFGQKQFLPQSAMVKWLSTHICTHVIMKELCANIFFLICGFNEKNLNMSRVDVYTTHCPAGTSVQNMVHWTQVVKYHKLQAFDWGSSDKNYFHYNQSYPPLYSIKDMQLPTALWSGGKDWLADTSDINILLTEIPTLVYHKNIPEWDHLDFIWGLDAPWRLYNEVVSLMKKYQ

lipA

Lipoyl synthase

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.126 kDa

MTQPIIRSIPLHVVSNDHPSSSPLQPGVKQSGEDKIGRSPVQFADVPVLRKPSWIRVRIPSGNAVQSLKAKLRENRLVTVCEEAACPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDPEEPISLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFVDCIAAIRQSAPQTRIEILTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRPGADYQWSLTLLKRFKAQHPQVPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTVGQYLQPTPHHHPVLRYWTPDEYKALEEYGMALGFSHVASGPMVRSSYHADHQAKEAGLGFNATVSLGSPAVSSTEHRERNTIASKSASKTESIHHR

lipA

Lipoyl synthase

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.158 kDa

MTQPIVRSIPLHVVSNDHPSSSPLQPGVKQSGEDKIGRSPVQFADVPVLRKPSWIRVRIPSGNAVQSLKAKLRENRLVTVCEEAACPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDPEEPISLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFVDCIAAIRQSAPQTRIEILTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRPGADYQWSLTLLKRFKAQHPQVPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTIGQYLQPTSHHHPVLRYWTPDEYKALEEYGMALGFSHVASGPMVRSSYHADHQAKEAGLGFNATVSLGSPAVSSTEHRERHTIASKSASKTESIRHR

lipA

Lipoyl synthase

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.085 kDa

MTQPIVRSIPLHVVSNDHPSSSPLQPGVKQSGEDKIGRSPVQFADVPVLRKPSWIRVRIPSGNAVQSLKAKLRENRLVTVCEEAACPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDPEEPISLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFVDCIAAIRQSAPQTRIEILTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRPGADYQWSLTLLKRFKAQHPQVPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTVGQYLQPTSHHHPVLRYWTPDEYKALEEYGMALGFSHVASGPMVRSSYHADHQAKEAGLGFNATVSLGSPAVSSTEHRERHTIASKSASKTESIPHR

lipA

Lipoyl synthase

373 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

41.126 kDa

MTQPIIRSIPLHVVSNDHPSSSPLQPGVKQSGEDKIGRSPVQFADVPVLRKPSWIRVRIPSGNAVQSLKAKLRENRLVTVCEEAACPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDPEEPISLARTVAEMGLKYVVVTSVDRDDLRDGGAQHFVDCIAAIRQSAPQTRIEILTPDFRGKGRMDRALDILAACPPDVFNHNVETVPALYPNVRPGADYQWSLTLLKRFKAQHPQVPTKSGIMLGLGETLDQVQATLRDLRAHDVDMVTVGQYLQPTPHHHPVLRYWTPDEYKALEEYGMALGFSHVASGPMVRSSYHADHQAKEAGLGFNATVSLGSPAVSSTEHRERNTIASKSASKTESIHHR

lipA

Lipoyl synthase

372 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

40.576 kDa

MAQFSPKPEWLKVRAPGGDTYHHLKETFRKLDLHTVCEEARCPNVGECWREGTATVMLLGDVCTRGCRFCAVTTGDPRGAVDVREPEHVARAIARLSLQYVVMTMVNRDDLLDGGAEHVARTVSRLHALRPDLLIETLVGDFQGHMSAVDMVVDAGPDVFAHNVEVVRRITRVIRDVRSSYDQSLAVLRRAKERQRRLAADAAEAGAPAPRRLTKSSIMVGIGETDDEVLEALRDLREAGVDIVTIGQYLRPSSKHAPVQRFVEPETFAAFERAALEMGFLYAASAPLVRSSYKAAEVFVRSLMDRGGAALPASPGAAAVEALLEERLAVARREAARLTAELDPDEPRPPVAPAPASASPARLVPAASLIRR

LIPA

Ligninase A

372 amino acids

Depolymerization of lignin. Catalyzes the C(alpha)-C(beta) cleavage of the propyl side chains of lignin.

Belongs to the peroxidase family. Ligninase subfamily.

39.394 kDa

MAFKQLVAAISLALSLTTANAAVVKEKRATCSNGATVGDASCCAWFDVLDDIQQNLFQGGQCGAEAHESIRLVFHDAIAISPAMEAQGKFGGGGADGSIMIFDDIEPNFHPNIGLDEIINLQKPFVQKHGVTPGAFIAFAGAVALSNCPGAPQMNFFTGRAPATQPAPDGLVPEPFHTVDQIIARVNDAGEFDELELVWMLSAHSVAAVNDVDPTVQGLPFDSTPGIFDSQFFVETQFRGILFPGSGGNQGEVESGMAGEIRIQTDHTLARDSRTACEWQSFVNNQSKLVSDFQFIFLALTQLGQDPNAMTDCSDVIPISKPIPGNLPFSFFPPGKSMKDVEQACAETPFPSLVTLPGPATSVARIPPPPGA

lipA

Lipoyl synthase

363 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

40.96 kDa

MTVKPEGRKMLRIEKKNAESPIEQKPRWIRNQVRTGPGYEDMKSRVTGASLHTVCQEAGCPNIHECWESREATFLIGGDKCTRRCDFCDIATGKPAELDRDEPRRVAENIQEMDLNYTTITGVTRDDLPDEGAWLYAEVVRKIHELNPNTGVENLTPDFSGKPDLLQEVFEARPEVFAHNLETVPRIFKRIRPAFRYERSLDVIRQAHDFGLITKSNLILGMGETAEEIEEALRDLRSAGCDIITITQYLRPGPRFHPIERWVRPEEFVEHSKLAKELGFGGVMSGPLVRSSYRAGRLYVQAMEARGLELPENLKHLAETSQGATAQEASTLLEKYGPSEETPVTTRMAKTPAQSNSVAATIR

lipA

Lipoyl synthase

355 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.989 kDa

MTNLDRHLSKFAYREEFAGNTEVLATAAYKEDCADASTGLTPKLPLEVEFGKMSKRPDWIKVKAPNSSEYYNTKDLIKNLKLNTVCEEAACPNIGECWSKKHATVMILGSVCTRACRFCNVKTGRPDLLDPHEPQRLAEAVQKLGLKHVVITSVDRDDLEDGGATHFAECISEIRKSSPNTTIEILTPDFLRKDGAAEIIANAKPDVFNHNVETVPSLYNTIRPGARYYNSLSLLHNIKKLSPEVFTKSGMMVGLGEEISEVVQVMDDLREAKVDFLTIGQYLQPTKNHAEVAKYVTPEEFKYLERVARTKGFLMVSASPLTRSSYHADEDFEKLKENYRHRHCEERRSIDVAIS

lipA

Lipoyl synthase

352 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

38.871 kDa

MTSVDTPTPHGGTPAPAPATANGRKLLRIEARNAQTPIERKPKWIRTRATMGPEYSELKGLVKREGLHTVCEEAGCPNIFECWEDREATFLIGGEQCTRRCDFCQIDTGKPAALDRDEPRRVAESVQAMGLRYSTITGVARDDLEDGGAWLYAETVRAIKRLNPATGVELLIPDFNADPDQLAEVFSARPEVLAHNLETVPRIFKRIRPAFRYERSLSVLTAAREAGLVTKSNLILGMGETPEEVTEAMRDLHEAGCDILTITQYLRPSPRHHPVDRWVKPEEFVEHSRVAEEIGFAGVMAGPLVRSSYRAGRLYAQAMAHHGREIPPAMAHLAEEGTASQEASAVLARFGS

lipA

Lipoyl synthase

351 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.596 kDa

MNDSGNSSKVNVRPPSAGLGAPSPGKRKMLRLEVRNSQVPIERKPSWIRARATIGTEYRKVQERVKKQNLRTVCQEAGCPNIYECWEDREATFLIGGSQCTRRCDFCQIDTGKPAELDLDEPKRVGQSVAQMKLRYATVTGVARDDLPDGGVWLYAETIREIHKQCPGSGVEILIPDFNGKPELLQQIFEAQPEVYAHNIETVPRIFRRIRPAFRYDRSLDVISQGQKAGMITKSNLILGMGETGEEVTQALRDLKSAGCDIVTITQYLRPSPRHLPVARWVKPQEFIEYKEQAKEIGFSGVLAGPLVRSSYRAGKLWAQSVKAKMVEIPERVRKLINEIEMQETSFRQAV

lipA

Lipoyl synthase

351 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.596 kDa

MNDSGNSSKVNVRPPSAGLGAPSPGKRKMLRLEVRNSQVPIERKPSWIRARATIGTEYRKVQERVKKQNLRTVCQEAGCPNIYECWEDREATFLIGGSQCTRRCDFCQIDTGKPAELDLDEPKRVGQSVAQMKLRYATVTGVARDDLPDGGVWLYAETIREIHKQCPGSGVEILIPDFNGKPELLQQIFEAQPEVYAHNIETVPRIFRRIRPAFRYDRSLDVISQGQKAGMITKSNLILGMGETGEEVTQALRDLKSAGCDIVTITQYLRPSPRHLPVARWVKPQEFIEYKEQAKEIGFSGVLAGPLVRSSYRAGKLWAQSVKAKMVEIPERVRKLINEIEMQETSFRQAV

lipA

Lipoyl synthase

350 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

38.651 kDa

MSDTSSPKPVASGEKFRTAQGITAIKDGQKRRASAEPQVFEPKPKWLRVKAPGGSRFEAVKRNVGEHRLSTVCQESHCPNMGECWSNGTATIMLMGSVCTRACRFCAVDTGNPNGWLDLEEPQNTAKSVELMALRYIVLTSVDRDDLEDGGASHYAACVRAIKENTPQVVVEALTPDFDGDHQAIERVVDSGLEVFAQNVETVKRLTHVVRDPRAGYEKTLKVLEHAKKHRPQVLTKTSLMLGLGETDEEILETMDDLRAIGVDILTLGQYLQPTRNHLKVQRWVSPEEFNRLRDIGLEKGFMEVAAGPLVRSSYRADRVFEKNNLGLAAPLPVPGQEVDASLIPALNLN

lipA

Lipoyl synthase

349 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.346 kDa

MSVTADGRRMLRIEAKNAETPIESKPRWIRTTAKVGPEYRDIKNRVKGAGLHTVCQEAGCPNINECWEDREATFLIGGDTCSRRCDFCQIKSGRPSPLDMDEPRRVAENVREMGLRYATITGVTRDDLDDEGAWLYAEVVKKIHELNPNTGVENLTPDFSNRPELLKVVFDSQPEVFAHNLETVPRIFKRIRPAFKYDRSLEVIQAAHDYGLVTKSNLILGMGEKKEEVRAAIKDLADAGTDILTITQYLRPSSMHHPIERWVKPEEFMEHSDAAYELGIKAVMSGPLVRSSYRAGRLYAQAKQARGEAIPENLKHLEETLDSTTSQEASTLLERYGASEDTPVTASRR

lipA

Lipoyl synthase

349 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.123 kDa

MTKAPEGRRMLRVEARNSQTPIESKPRWIRTAVKTGPEYQDMKKKVSGASLHTVCQEAGCPNIHECWESREATFLIGGANCSRRCDFCQINSAKPEPLDRDEPRRVAESVREMQLNYSTITGVTRDDLEDEGAWLYAEVVRKIHELNPHTGVENLTPDFSGKPDLLQEVFEARPEVFAHNLETVPRIFKRIRPAFRYERSLDVIRQARDFGLVTKSNLILGMGETVDEIRDALVDLHSAGCDIITITQYLRPGPMYHPIDRWVKPEEFIDHADFARELGFGAVMSGPLVRSSYRAGKLYAEALAARGESLPENLAHLATTADGSTAQEANTLLEKYGPSQDTPVVSSKA

lipA

Lipoyl synthase

348 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

38.55 kDa

MSESAKPRITSGSKFRNEHGFSAIKDGVKRSSSNTEGKSLERKPKWLRARMPGGERYDAVRRNVTEHRLSTVCQESHCPNIGECWTNGTATIMVMGSVCTRACKFCAVDTGNPKGWLDPEEPENTAKSVELMGLRYIVLTSVDRDDLPDGGAAHYAACVSAIKQRTPEVAVEALTPDFDAVMSDVEKVVDSGLDVFAQNVETVKRLTSRVRDPRAGYEKTLSVLAHAKKHRPDVLTKTSLMLGLGETEEEILETMDDLRAIGVDILTLGQYLRPTPNHLPVERYVTPEEFNRYRDIGLEKGFMEVPSGPMVRSSYRADRVFDKNNLGLSVPEVPVPDKAMQIPVKAVD

lipA

Lipoyl synthase

348 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

38.55 kDa

MSESAKPRITSGSKFRNEHGFSAIKDGVKRSSSNTEGKSLERKPKWLRARMPGGERYDAVRRNVTEHRLSTVCQESHCPNIGECWTNGTATIMVMGSVCTRACKFCAVDTGNPKGWLDPEEPENTAKSVELMGLRYIVLTSVDRDDLPDGGAAHYAACVSAIKQRTPEVAVEALTPDFDAVMSDVEKVVDSGLDVFAQNVETVKRLTSRVRDPRAGYEKTLSVLAHAKKHRPDVLTKTSLMLGLGETEEEILETMDDLRAIGVDILTLGQYLRPTPNHLPVERYVTPEEFNRYRDIGLEKGFMEVPSGPMVRSSYRADRVFDKNNLGLSVPEVPVPDKAMQIPVKAVD

lipA

Lipoyl synthase

348 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.311 kDa

MTIAPEGRRLLRVEARNSETPIETKPRWIRNQVKNGPEYQDMKERVAGASLHTVCQEAGCPNIHECWESREATFLIGGANCSRRCDFCMINSARPEPLDRGEPLRVAESVREMQLNYSTITGVTRDDLDDEGAWLYSEVVRKIHELNPHTGVENLVPDFSGKKDLLQEVFESRPEVFAHNVETVPRIFKRIRPAFRYERSLDVIRQARDFGLVTKSNLILGMGETKEEITEALQDLHDAGCDIITITQYLRPGPLFHPIERWVKPEEFLEHADAAKEMGFAAVMSGPLVRSSYRAGRLYAQAMEFRGEEIPAHLAHLKDTSGGSTAQEASTLLERYGASEDTPVVSFN

lipA

Lipoyl synthase

348 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.311 kDa

MTIAPEGRRLLRVEARNSETPIETKPRWIRNQVKNGPEYQDMKERVAGASLHTVCQEAGCPNIHECWESREATFLIGGANCSRRCDFCMINSARPEPLDRGEPLRVAESVREMQLNYSTITGVTRDDLDDEGAWLYSEVVRKIHELNPHTGVENLVPDFSGKKDLLQEVFESRPEVFAHNVETVPRIFKRIRPAFRYERSLDVIRQARDFGLVTKSNLILGMGETKEEITEALQDLHDAGCDIITITQYLRPGPLFHPIERWVKPEEFLEHADAAKEMGFAAVMSGPLVRSSYRAGRLYAQAMEFRGEEIPAHLAHLKDTSGGSTAQEASTLLERYGASEDTPVVSFN

lipA

Lipoyl synthase

348 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.384 kDa

MTIAPEGRRMLRVEARNSQTPIETKPRWIRNQVKNGPEYKDMKERVAGASLHTVCQEAGCPNIHECWESREATFLIGGANCSRRCDFCMINSARPEPLDRGEPLRVAESVREMRLNYSTITGVTRDDLPDEGAWLYSEVVRKIHELNPNTGVENLVPDFSGKRDLLQEVFESRPEVFAHNLETVPRIFKRIRPAFRYDRSLDVIRQARDFGLVTKSNLILGMGETREEISEALRDLHSAGTDIITITQYLRPGPLFHPIERWVKPEEFLELSDEAYEIGFAAVMSGPLVRSSYRAGKLYAQALKFRGEELPANLSHLAETTEGPTTQEASSLLERYGASEDAPVIPRG

lipA

Lipoyl synthase

347 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.087 kDa

MAVAPNGRRLLRIEARNAQTPIEAKPRWIRTTATMGPEFRDMKKRVKGAGLHTVCQEAGCPNIHECWEDREATFLIGGDTCSRRCDFCDIKSGRPEPLDEDEPRRVAENVREIGLRYSTITGVTRDDLPDEGAWLYAEVVRQIHKLNPNTGVENLTPDFSGKPDLLQTVFEARPEVFAHNLETVPRIFKRIRPAFRYERSLDVIRQARDFGLVTKSNLILGMGETVDEVKSAMRDLRDAGCDILTVTQYLRPSNLHHPIERWVKPEEFVMYRDYGHDIGFAGVMAGPLVRSSYRAGRLYAQAIKARGEELPANLQHLGEGIDDTASQEASTLLSKYGASRETPVGAR

lipA

Lipoyl synthase

347 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.503 kDa

MTVSANGRRMLRIEAKNSQTPIEAKPRWIRTTAKMGPEYRDMKNRVTGMSLHTVCQEAGCPNIHECWEDREASFLIGGDTCSRRCDFCQIKSGKPTPLDRDEPRRVAESVREMGLKYATVTGVTRDDLDDEGAWLYAEVVRKIHELNPNTGVENLTPDFSNKPELLQIVFESQPEVFAHNLETVPRIFKRIRPAFKYERSLEVIRAAHDYGLITKSNLILGMGETEEEVVEAMRDLREAGTDILTITQYLRPTSMHHPIERWVRPEEFVAHSEAAYDMGFPAVMSGPLVRSSYRSGRLYAQAMRARGREIPENLSHLNEKLDGSTQQEATNLLDKYGASEETPVAYR

lipA

Lipoyl synthase

347 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.109 kDa

MTNAVQTHMPAARAKPKKAIQGEKLRGYDKVARIPIKIIPTVEAKKKPDWIRVKLSSPAEVARIKSTLREQKLYTVCEEAACPNLPQCFADGTATFMIMGDICTRRCPFCDVGHGRPNELDKDEPRHTAETIQGLGLKYAVITSVDRDDLKDGGAAHFVEVLNESRALSPNCLIEILVPDFRGRMDIALDLLTETAPDVFNHNIETVPRLYKAFRPGSDYQHSLDLLKIYKERRPDIATKCGFMVGLGETEEEIYKLLDDLKAHNVDMITVGQYLQPSKDHAPVDRYVHPDEFQRYMDYGKKIGFFNIWAGPMVRSSYFADRQYYGEDCPAPIRSKKALAAEGKLGC

lipA

Lipoyl synthase

347 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.139 kDa

MTNAVQTHTPAARAKPKKAIQGEKLRGYDKVARIPIKIIPTVEAKKKPDWIRVKLSSPAEVARIKSTLREQKLYTVCEEAACPNLPQCFADGTATFMIMGDICTRRCPFCDVGHGRPNELDKDEPRHTAETIQGLGLKYAVITSVDRDDLKDGGAMHFVEVLNESRALSPNCLIEILVPDFRGRMDIALDLLTETAPDVFNHNIETVPRLYKAFRPGSDYQHSLDLLKIYKERRPDIATKCGFMVGLGETEEEIYKLLDDLKAHNVDMITVGQYLQPSKDHAPVDRYVHPDEFQRYMDYGKKIGFFNIWAGPMVRSSYFADRQYYGEDCPAPIRSKKALAAEGKLGC

lipA

Lipoyl synthase

347 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

39.119 kDa

MTTTVETFVPEAPPKPKKAIKGEKLRGYDKVARIPIKVIPTVEAPKKPDWIRVKMSSPAEVDRIKKTLRKQKLYTVCEEAACPNLPQCFGDGTATFMIMGDICTRRCPFCDVAHGRPNELDKDEPRHTAETIQGLGLKYAVITSVDRDDLKDGGAQHFVDVINESKALSPNCLIEILVPDFRGRMDVALDLLTETAPDVFNHNIETVPRLYKAFRPGSDYQHSLDLLKQYKARRPDIATKCGFMVGLGETEEEVYALLDDLKAHDVDMITIGQYLQPSKNHAPVDRYVHPDEFQRYMDYGKKIGFFSIWAGPMVRSSYFADRQYYGEDCPAPIRSKKALEAEGKLGC

lipA

Lipoyl synthase

341 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

38.187 kDa

MTTDAVQTMIPTLDITERPAPAPRAKVEAGVKLRGAEKVARIPVKIIPTTELPKKPDWIRVRIPVSPEVDRIKALLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVNEPESLAIAIADLKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLSPNVMLETLVPDYRGRMDVALEITAAEPPDVFNHNLETVPRLYKAARPGSDYQWSLTLLQKFKQMMPHIPTKSGLMLGLGETDEEVIEVMKRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADEQAKLVKASLVS

lipA

Lipoyl synthase

340 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

38.185 kDa

MTTDAVQTMIPTLDVTERPAPRPKVEAGVKLRGAEKVARIPVKIIPTTELPKKPDWIRVRIPVSPEVDRIKSLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVNEPESLAIAIADLKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLSPNVQLETLVPDYRGRMDIALEITAAEPPDVFNHNLETVPRLYKAARPGSDYQWSLTLLQRFKQMMPHIPTKSGLMLGLGETDDEVIEVMKRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADEQAKLVKAELLGS

lipA

Lipoyl synthase

339 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.387 kDa

MAVVLDLLNKDTRPKLDAPARPRHPEKAHRPDTAIQRKPDWIRVKAPGSKLWAETKDIVRANNLVTVCEEAGCPNIGECWEKRHATFMIMGDTCTRACSFCNVRTGLPAALDEAEPEKVAEAVAKLGLHHVVVTSVDRDDLKDGGAEHFSRTIAAIRRASPGTTVEILTPDFLRKPGALEVVVAAKPDVFNHNMETVPGKYVTVRPGARYFHSVRLLQRVKELDPTIFTKSGIMVGLGEERNEVVQLMDDLRSAEVDFLTIGQYLQPTRKHHEVVRFVPPDEFKAYETTAYAKGFLLVSATPLTRSSHHAGEDFARLKAARLAKLGPAPVAASIRAVNA

lipA

Lipoyl synthase

339 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.415 kDa

MAVVLDLLNKDTRPKLDAPARPRHPEKAHRPDTAIQRKPDWIRVKAPGSKLWAETKDIVRANNLVTVCEEAGCPNIGECWEKRHATFMIMGDTCTRACSFCNVRTGLPAALDEAEPEKVAEAVAKLGLHHVVVTSVDRDDLKDGGAEHFSRTIVAIRRASPGTTVEILTPDFLRKPGALEVVVAAKPDVFNHNMETVPGKYVTVRPGARYFHSVRLLQRVKELDPTIFTKSGIMVGLGEERNEVVQLMDDLRSAEVDFLTIGQYLQPTRKHHEVVRFVPPDEFKAYETTAYAKGFLLVSATPLTRSSHHAGEDFARLKAARLAKLGPAPVAASIRAVNA

lipA

Lipoyl synthase

339 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.387 kDa

MAVVLDLLNKDTRPKLDAPARPRHPEKAHRPDTAIQRKPDWIRVKAPGSKLWAETKDIVRANNLVTVCEEAGCPNIGECWEKRHATFMIMGDTCTRACSFCNVRTGLPAALDEAEPEKVAEAVAKLGLHHVVVTSVDRDDLKDGGAEHFSRTIAAIRRASPGTTVEILTPDFLRKPGALEVVVAAKPDVFNHNMETVPGKYVTVRPGARYFHSVRLLQRVKELDPTIFTKSGIMVGLGEERNEVVQLMDDLRSAEVDFLTIGQYLQPTRKHHEVVRFVPPDEFKAYETTAYAKGFLLVSATPLTRSSHHAGEDFARLKAARLAKLGPAPVAASIRAVNA

lipA

Lipoyl synthase

339 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.415 kDa

MAVVLDLLNKDTRPKLDAPARPRHPEKAHRPDTAIQRKPDWIRVKAPGSKLWAETKDIVRANNLVTVCEEAGCPNIGECWEKRHATFMIMGDTCTRACSFCNVRTGLPAALDEAEPEKVAEAVAKLGLHHVVVTSVDRDDLKDGGAEHFSRTIVAIRRASPGTTVEILTPDFLRKPGALEVVVAAKPDVFNHNMETVPGKYVTVRPGARYFHSVRLLQRVKELDPTIFTKSGIMVGLGEERNEVVQLMDDLRSAEVDFLTIGQYLQPTRKHHEVVRFVPPDEFKAYETTAYAKGFLLVSATPLTRSSHHAGEDFARLKAARLAKLGPAPVAASIRAVNA

lipA

Lipoyl synthase

338 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

38.044 kDa

MTTVQEAVPNLIPTQDVTPRPAPKKVEAGVKLRGAEKVARIPVKIIPTEELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDLDEPKNLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRALSPGVQLETLVPDYRGRMDVALEITAQTPPDVFNHNLETVPRLYKAARPGSDYDWSLDLLQKFKQMVPHVPTKSGLMLGLGETDEEVIEVMHRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADQQAHEAKIKL

lipA

Lipoyl synthase

338 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.957 kDa

MTTVQEAVPNLIPTQDATPRPAPKKVEAGVKLRGADKVARIPVKIIPTDELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDLDEPKNLAVAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRALSPGVQLETLVPDYRGRMDVALEITAQEPPDVFNHNLETVPRLYKAARPGSDYDWSLDLLQKFKQLVPHVPTKSGLMLGLGETDEEVIEVMHRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADQQAHEAKIKL

lipA

Lipoyl synthase

338 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.957 kDa

MTTVQEAVPNLIPTQDATPRPAPKKVEAGVKLRGADKVARIPVKIIPTDELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDLDEPKNLAVAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRALSPGVQLETLVPDYRGRMDVALEITAQEPPDVFNHNLETVPRLYKAARPGSDYDWSLDLLQKFKQLVPHVPTKSGLMLGLGETDEEVIEVMHRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADQQAHEAKIKL

lipA

Lipoyl synthase

338 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.961 kDa

MTTVQEAVPNLIPTQDATPRPAPKKVEAGVKLRGADKVARIPVKIIPTDELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVDEPKNLAVAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRALSPGVQLETLVPDYRGRMDVALEITAQEPPDVFNHNLETVPRLYKAARPGSDYDWSLDLLQKFKQMVPHVPTKSGLMLGLGETDEEVIEVMHRMREHDIDMLTLGQYLQPSRSHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADQQAHEAKIKL

lipA

Lipoyl synthase

337 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.864 kDa

MTQPIARSIPLQVVSGDTAAPAPLQTGVKQIGGDKINRSPVQFVDAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDASEPASLAATVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRTSSPNTRIEILTPDFRGKGRMDRALEILALSPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPSIATKSGIMLGLGETMEQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYKALEDYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA

lipA

Lipoyl synthase

337 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.834 kDa

MTQPIARSIPLQVVSGDTAAPAPLQTGVKQIGGDKINRSPVQFVDAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDASEPASLAATVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRASSPNTRIEILTPDFRGKGRMDRALEILALSPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPSIATKSGIMLGLGETMEQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYKALEDYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA

lipA

Lipoyl synthase

337 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.896 kDa

MTQPIARSIPLQVVSGDTAAPASLQTGVKQIGGDKINRSPVQFVDAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDASEPASLATTVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRASAPKTRIEILTPDFRGKGRMDRALEILATSPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPTIATKSGIMLGLGETMEQVQVTLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYKALEEYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA

lipA

Lipoyl synthase

337 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.884 kDa

MTQPIARSIPLQVVSGDTAAPASLQTGVKQIGGDKINRSPVQFVDAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDASEPTSLATTVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRASAPKTRIEILTPDFRGKGRMDRALEILATSPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPTIATKSGIMLGLGETMEQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYKALEDYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA

lipA

Lipoyl synthase

337 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.896 kDa

MTQPIARSIPLQVVSGDTAAPASLQTGVKQIGGDKINRSPVQFVDAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDASEPASLATTVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRASAPKTRIEILTPDFRGKGRMDRALEILATSPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPTIATKSGIMLGLGETMEQVQVTLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYKALEEYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA

lipA

Lipoyl synthase

337 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.944 kDa

MTQPTARSIPLQVVSGDTAAPAPLQTGVKQIGGDKIHRSPVQFVDAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDANEPASLAITVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRTSSPNTRIEILTPDFRGKGRMDRALDILALSPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPSIATKSGIMLGLGETMEQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYKALEEYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA

lipA

Lipoyl synthase

337 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.944 kDa

MTQPTARSIPLQVVSGDTAAPAPLQTGVKQIGGDKIHRSPVQFVDAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFSHGTATFMILGEVCTRRCSFCDVAHGRPKPPDANEPASLAITVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIRTSSPNTRIEILTPDFRGKGRMDRALDILALSPPDVFNHNIETVPDLYPNVRPGADYQWSLTLLQRFKAQHPSIATKSGIMLGLGETMEQVQATLRDLRAHDVDMITIGQYLQPTPHHHPVMRYWTPEEYKALEEYGNALGFSHVASGPMVRSSYHADRQAAGAGVAA

lipA

Lipoyl synthase

336 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.062 kDa

MTESTARSIPLQIVQGDSPSAAPLQAGVKQLGGDKINRSPVQFADAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFGHGTATFMILGEVCTRRCSFCDVAHGRPKPPDANEPASLGQTVADMGLKYVVVTSVDRDDLRDGGAQHFVDCISAIREKSPGTRIEVLTPDFRGKGRMERALEILAQNPPDVFNHNIETVPDLYRNVRPGADYQWSLNLLKNFKAQHPEVPTKSGIMLGLGEEFEQIKATMRDLRAHDVDMITIGQYLQPTAHHHPVLKYWTPEDYKALEDYGYELGFSHVASGPMVRSSYHADVQAKGAGVS

lipA

Lipoyl synthase

336 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.044 kDa

MTETTARSIPLQIVQGDSPSAAPLQAGVKQLGGDKINRSPVQFADAPVLRKPSWIRVRIPSGNAVQNLKAKLRENRLVTVCEEASCPNIHECFGHGTATFMILGEVCTRRCSFCDVAHGRPKPPDANEPASLGQTVADMGLKYVVVTSVDRDDLRDGGAQHFVDCITAIREKSPGTRIEVLTPDFRGKGRMERALEILAQNPPDVFNHNIETVPDLYRNVRPGADYQWSLNLLKNFKAQHPDVPTKSGIMLGLGEDFEQIKATLRDLRAHDVDMITIGQYLQPTAHHHPVLKYWTPEDYKALEDYGYELGFSHVASGPMVRSSYHADVQAKGAGVS

lipA

Lipoyl synthase

335 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.98 kDa

MTIAPEGRKLLRVEARNAEVPIEKKPSWLKNTAKMGPQFTELKSMARGRGLHTVCEEAGCPNIYECWEDREATFLIGGDTCTRRCDFCDIATGKPGMVDVAEPRKVAESVRDLGLRYATVTSVARDDLADGGAWLNAETIRAIHAMNPSTGVEILIPDFKGQPDAVQQVIDAQPEVFAHNLETVPRIFKQIRPAFAYERSLDVLTQGKEHGMIVKSNLILGMGETDDEVYEALCDLHDAGCDIITLTQYLRPGPTFHPIDRWVKPETFVELSKAAEEIGFLGVMAGPMVRSSYRAGKLWARAMKKMGREIPEHLSHIDDSGSATQEASSLLARLG

lipA

Lipoyl synthase

335 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.637 kDa

MSLAPEGRRLLRVEARNAEVPVERKPEWIKAKVHMGPEYIGLKNKVKSAGLHTVCEEAGCPNIFECWEDREATFLIGGDICTRRCDFCDITSGKPRPLDMEEPQKVAENIREMDLRYATVTGVARDDQKDGAAWLYAETIRRIHALNPGTGVEILPPDFGAVPELVQQVFDARPEVFAHNLETVPRIFKRIRPAFTYEKSLRVLTMAKADGLVTKSNLILGMGEEDHEIDQALVDLHESGCDIITITQYVRPSKLHHPIDRWVKPQEFVQWSQRAEEIGFQGVMAGPLVRSSYRAGKLYAQAMQRLGRTLPENLAHLAGEKTARQEASAVVAQMS

lipA

Lipoyl synthase

335 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.665 kDa

MTDTVQTLIPTLDVSERVARPKVEAGVKLRGAEKVARIPVKIIPTVDLPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVNEPKSLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRLLSPGVQLETLVPDYRGRMDVALEITAAEPPDVFNHNLETVPRLYKAARPGSDYQWSLTLLQRFKQMVPHVPTKSGLMLGLGETDEEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADEQAKIAKAML

lipA

Lipoyl synthase

335 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.665 kDa

MTDTVQTLIPTLDVSERVARPKVEAGVKLRGAEKVARIPVKIIPTVDLPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVNEPKSLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCIREIRLLSPGVQLETLVPDYRGRMDVALEITAAEPPDVFNHNLETVPRLYKAARPGSDYQWSLTLLQRFKQMVPHVPTKSGLMLGLGETDEEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGYKMGFKNVASGPLVRSSYHADEQAKIAKAML

lipA

Lipoyl synthase

335 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.333 kDa

MTIDTNPESSTPSAPAYNPSEKQKGSAKTIRIPIKVVPMERLPKPDWIRVKAGSPSTRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPENLAKTIAALRLNYVVITSVDRDDLRDGGAGHFAECIRRVRELSPNTRIEILVPDFRGRMDRALEILNLAPPDVMNHNLETAPRLYKEARPGSDYAYSLNLLKRFKALHPNTPTKSGIMVGLGETDEEVLQVMRDMRAHDVDMLTIGQYLMPSGDHLPVRRYVHPDTFKMYEEEAYKMGFAHAAVGAMVRSSYHADQQAHGVTAGASQLPHD

lipA

Lipoyl synthase

334 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.842 kDa

MAVVLDLLNNDTRPKVEAPARPRHPEKAHRPDTAIQRKPDWIRVKAPGSKLWAETKDIVRANNLVTVCEEAGCPNIGECWEKRHATFMIMGDTCTRACAFCNVRTGLPESLDAAEPEKVADAVAKLGLHHVVVTSVDRDDLKDGGAEHFSRTIAAIRRASPGTTVEILTPDFLRKPGALEVVVAAKPDVFNHNLETVPGKYVTVRPGARYFHSVRLLQRVKELDPTIFTKSGIMVGLGEERNEVVQLMDDLRSAEVDFLTIGQYLQPTRKHHEVVRFVPPDEFKAYETTAYAKGFLLVSATPLTRSSHHAGEDFARLKAARLAKLGPAPVAVNA

lipA

Lipoyl synthase

334 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.271 kDa

MSDALIAPNASSSEAPQSPAEHYDPTRKQKSADKTARIPIKIVPAEKLKKPDWIRVKAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYVDCISQTRELSPATRIEVLVPDFRGRLDKALDILQACPPDVMNHNMETVPRLYKQARPGADYAHSLKLLQEFKRRNPNVPTKSGLMVGLGETDEEILEVMRDMRAHDIDMLTIGQYLAPSNHHLPVLRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA

lipA

Lipoyl synthase

334 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.704 kDa

MSEFKGIPVSSGSVVERDGVRTIKDGVKRRDDGQGAVRRRKPQWLKARAPGGEGYRSVRGIVHDHHLSTVCEESHCPNLGECWSHGTATFMVLGSVCTRTCRFCSVDTGNPKGRLDPQEPEHCAESVRLMGLRYVVLTSVDRDDLPDGGAEHYAQCVRAIKADNPDTAVEALTPDFRGDEEAVRTVVDSGLEVFAHNVEVVRRLSPQVRDPRAGYEQSLAVLQVAKRLRPGVLTKSSLMVGLGETDAEIDEAFDDLLRAEVDIVTLGQYLQPTRNHLPVERFVSPDEFEALRQEGLRRGFREVVAGPLVRSSYRADRVLEGNNVGLPSVGPDVG

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.103 kDa

MSTLVESPVPSNDSQAAAPAAYDPTQKQKSQAKTARIPIKVVAAEKLKKPEWIRVRAAAPGSRFYDIKRILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDTQEPENLARTIAALKLSYVVITSVDRDDLRDGGAAHFVECIAKVREYSPDTRIEVLVPDFRGRLDRALHILNSGPPDVMNHNLETVPRLYKQARPGSDYAHSLKLLAEFKKLHPEVPTKSGLMLGLGETDEEILQVMRDMREHNVDMLTIGQYLQPSEHHLPVLRYVHPDTFAMFEREAYAMGFTHAAVGAMVRSSYHADQQAHAAGVN

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.131 kDa

MSTLVESPVPSNDSQAAAPAAYDPTQKQKSQAKTARIPIKVVAAEKLKKPEWIRVRAAAPGSRFYDIKRILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDTQEPENLARTIAALKLSYVVITSVDRDDLRDGGAAHFVECIAKVREYSPDTRIEVLVPDFRGRLDRALHILNSGPPDVMNHNLETVPRLYKQARPGSDYAHSLKLLVEFKKLHPEVPTKSGLMLGLGETDEEILQVMRDMREHNVDMLTIGQYLQPSEHHLPVLRYVHPDTFAMFEREAYAMGFTHAAVGAMVRSSYHADQQAHAAGVN

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.103 kDa

MSTLVESPVPSNDSQAAAPAAYDPTQKQKSQAKTARIPIKVVAAEKLKKPEWIRVRAAAPGSRFYDIKRILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDTQEPENLARTIAALKLSYVVITSVDRDDLRDGGAAHFVECIAKVREYSPDTRIEVLVPDFRGRLDRALHILNSGPPDVMNHNLETVPRLYKQARPGSDYAHSLKLLAEFKKLHPEVPTKSGLMLGLGETDEEILQVMRDMREHNVDMLTIGQYLQPSEHHLPVLRYVHPDTFAMFEREAYAMGFTHAAVGAMVRSSYHADQQAHAAGVN

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.885 kDa

MTIAPEGRRMLRIEARNAETPIERKPSWIRTKARTGPDYTELKGLVKSGGLHTVCEEAGCPNIYECWEDREATFLIGGSECTRRCDFCQIDTGKPSPLDRDEPRRVAESIATMGLRYATITGVARDDLDDGGAWLYAETIRATHAANPGTGVEILVPDFNGKPELLQQVFDAQPEVFAHNVETVPRIFKSIRPAFRYERSLDVITQGRDAGLVTKSNLILGMGETDEEVLEALADLRGAGCDIITITQYLRPTPRHHPVERWVKPEKFVEFSAEAERLGFAGVMAGPLVRSSYRAGRLWAQAMKRRGVAIPAQLAHLDKESPAAQEASSLLAR

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.305 kDa

MTAAPEGRKLLRLEVRNSQTPIEKKPSWIKTRARMGPEYQELKGLVKREGLHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDVEEPRRVAESVQAMGLRYSTVTGVARDDLEDGGAWLYAETVRQIHQLNPGTGVELLIPDFNADPGQLAEVFGSRPEVLAHNVETVPRIFKRIRPAFRYERSLEVITRAREDGLVTKSNLILGMGETPEEVTEALRDLREAGTDIITITQYLRPSPRHHPVERWVKPEEFVEHTRTAEELGFPGVMAGPLVRSSYRAGRLYAKATEHRGMPLPDNLAHLAKAGTAAQEASSLLSR

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.294 kDa

MTAVAPEGRPLLRIEARNAQTPIERKPSWIRTRLRTGPQYQDVKGLVQSAGLHTVCEEAGCPNIYECWEDREATFLIGGEVCTRRCDFCQIDSGRPAPLDHDEPRRVAESVATMGLRYATVTGVARDDLADGGSWLYAETVRQIHARSADTGVEVLIPDFGGRPDQLGEVFEAAPEVLAHNLETVPRIFRRIRPAFRYERSLDVLRQARQAGLVTKSNLILGLGETAEEIHTALRDLRSAGCELLTVTQYLRPTPRHHPVERWVRPEEFLDWGRVGAELGFSGVMSGPLVRSSYRASRLYQQAMTARDQDRSEMSVPPESVSENSHGQRPSPW

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.988 kDa

MTDSAAGATEVATPATPSNKPYDATAKQKSLDKTARIPIKIVPAEKLKKPDWIRVRAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPENLAKTIAELKLNYVVITSVDRDDLRDGGAQHYVDCISRTRALSPATRIEVLVPDFRGRLEKALDILQECPPDVMNHNLETVPRLYKQARPGADYAHSLKLLKDFKARNPNVPTKSGLMVGLGETDEEILEVMRDMREHDIDMLTIGQYLAPSGHHLPVLRYVHPDTFKMFEEKAYEMGFTHAAVGAMVRSSYHADQQAHEAGVV

lipA

Lipoyl synthase

333 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.084 kDa

MTDSASGASAVANIATPSNEPYDATRKQKSLDKTARIPIKIVPAEKLKKPEWIRVKAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDANEPENLAKTIAQLRLNYVVITSVDRDDLRDGGAQHYVDCISRTRELSPATRIEVLVPDFRGRLEKALDILQACPPDVMNHNMETVPRLYKQARPGADYAHSLKLLKDFKARNPNLPTKSGLMVGLGETDEEILEVMRDMREHDIDMLTIGQYLAPSGHHLPVLRYVHPDTFKMFEEKAYEMGFTHAAVGAMVRSSYHADQQAHEAGFA

lipA

Lipoyl synthase

332 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.752 kDa

MTIAPEGRRLLRVEARNAAVPIEKKPPWIKTRATMGPEYTELRSLVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPADFDADEPRRVAESVQAMGLRYSTVTGVARDDLADGGAWLYAETVRQIHALNPGTGVELLIPDFNAEPDQLAEVFSSRPEVLAHNLETVPRVFKRIRPGFRYARSLSVLTAARDAGLVTKSNLILGMGETTAEAVEALADLHAAGCDLVTITQYLRPSPRHHPVERWVKPEEFVELSDEAERIGFLGVMAGPLVRSSYRAGRLWGQAMARRGLEVPPALAHLTEPTTSRQEAASLLR

lipA

Lipoyl synthase

332 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.023 kDa

MASADRQMIGDATLAYDPRAKQKAAAKLARIPIKVEPGERLKKPDWIRVKAASPGTRFDDIKRILREHRLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDQDEPMNLARTVAALALEYVVITSVDRDDLRDGGSGHFVDCIQSIRKLSPQTRIEILVPDFRGRDDRALAILQAAPPDVMNHNLETAPRLYPQARPGSDYRFSLNLLKKFKALHPTVPTKSGIMVGLGETDEEILQVMRDMRAHGIEMLTIGQYLAPSSSHLPVRRYVHPDDFRMFEQEAYRMGFSHAAVGAMVRSSYHADRQAQAAGLHVNAPK

lipA

Lipoyl synthase

332 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.947 kDa

MSTPEVVREAQSTVAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPEWIRVKAGSPTTRFYEIKEILREHKLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKDEPLNLARTIAALKLKYVVITSVDRDDLRDGGSGHFVECIQNIRALSPATQIEILVPDFRGRDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLNLLKKFKALHPGVPTKSGIMVGLGETDEEILQVMRDMRAHDIDMLTIGQYLAPSNSHLPVRRYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADQQAHAAGLQAGPQG

lipA

Lipoyl synthase

332 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.947 kDa

MSTPEVVREAQSTVAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPEWIRVKAGSPTTRFYEIKEILREHKLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKDEPLNLARTIAALKLKYVVITSVDRDDLRDGGSGHFVECIQNIRALSPATQIEILVPDFRGRDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLNLLKKFKALHPGVPTKSGIMVGLGETDEEILQVMRDMRAHDIDMLTIGQYLAPSNSHLPVRRYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADQQAHAAGLQAGPQG

lipA

Lipoyl synthase

332 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.023 kDa

MSTPEVVREVQSLETYNPLAKQKAAAKLSRIPVKVVQGEILKKPDWIRVKAGSPSTRFYEIKQILRENKLNTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPLNLARTIAALKLKYVVITSVDRDDLRDGGSGHFVECIQRIRELSPGTTIEVLVPDFRGRDDRALEILKTSPPDVMNHNLETAPRLYKEARPGSDYQFSLNLLKKFKALHPDVPTKSGIMVGLGETDEEILQVMQDMRDHGINMLTIGQYLAPSTSHLPVRRYVHPDTFKMFEEKAYEMGFSHAAVGAMVRSSYHADQQAHAAGVSDKPAE

lipA

Lipoyl synthase

332 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.965 kDa

MSETNVQGSLAEAPKAAVKRVEQGVKLRGYDKVSRNPVKIIATDAVPRKPDWIRVRLSSSPSVEAIKQKLRKLNLHSVCEEASCPNLSECFSHGTATFMIMGDICTRRCPFCDVAHGRPNALDENEPTHLAQAIAEMNLKYVVITSVDRDDLRDGGAGHFAKCISESRKYSPNLKIEVLVPDFRGRMDVALDILRESPPDVFNHNLETVPRLYKQARPGADYAWSLLLLKRFKEAAPDVPTKSGLMLGIGEEIEEVKQVMRDLRAHNTDMLTLGQYLAPSKDHLPVVRFVHPDEFKELADYGYEIGFKQVASGPLVRSSYHADKQAAGETIS

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.799 kDa

MSTQLDASQPSNDVASPAAYDPTQKQKSQAKTARIPIKVIPAERLKKPEWIRVRAAAPGSRFYDIKRILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDAQEPENLARTIAALKLSYVVITSVDRDDLRDGGAAHFVECITKIRELSPITRIEVLVPDFRGRLDRALAILNAGPPDVMNHNLETVPRLYKQARPGSDYLHSLKLLAEFKALHPDVPTKSGLMLGLGETDEEILEVMRDMRAHNVDMITIGQYLQPSEHHLPVLRYVHPDTFAMFEREAYAMGFSHAAVGAMVRSSYHADEQAHAAGVN

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.041 kDa

MTTETNPAVTPAYNPSEKQKGAAKTIRIPIKVIPMERLPKPDWIRVKAASPSTRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPENLAKTIAALRLNYVVITSVDRDDLRDGGAGHFAECIRRVRELSPNTRIEILVPDFRGRMDRALEILNAAPPDVMNHNLETAPRLYKEARPGSDYEYSLNLLKRFKAQHPNTPTKSGIMVGLGETDEEVLQVMRDMRAHDVDMLTIGQYLMPSGDHLPVRRYVHPDTFKMYEEEAYKMGFAHAAVGAMVRSSYHADQQAHGVTSAQSDVVNK

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.783 kDa

MSTENTTRQAETGAAYDATAKQKAQAKTARIPIKVVPAETLKKPDWIRVKAGSPTTRFYEIKNILREHQLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPANLAKTIAALKLKYVVITSVDRDDLRDGGAGHYVECIRQTRAASPETRIEVLVPDFRGRMDRALEILKTAPPDVMNHNMETVPRLYKEARPGADYQFSLTLLKRFKEEVPGVPTKSGLMVGLGETDDEILDVMRDMRAHDIDMLTIGQYLAPSGHHLPVRRYVHPDTFRMFETEAYKMGFTHAAVGAMVRSSYHADQQAHQAGVDGAIG

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.783 kDa

MSTENTTRQAETGAAYDATAKQKAQAKTARIPIKVVPAETLKKPDWIRVKAGSPTTRFYEIKNILREHQLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPANLAKTIAALKLKYVVITSVDRDDLRDGGAGHYVECIRQTRAASPETRIEVLVPDFRGRMDRALEILKTAPPDVMNHNMETVPRLYKEARPGADYQFSLTLLKRFKEEVPGVPTKSGLMVGLGETDDEILDVMRDMRAHDIDMLTIGQYLAPSGHHLPVRRYVHPDTFRMFETEAYKMGFTHAAVGAMVRSSYHADQQAHQAGVDGAIG

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.024 kDa

MSDALIATSSEAPQSPAEQYDPTRKQKSADKTARIPIKIVPAEKLKKPDWIRVKAATGSSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYVDCISQTRELSPATRIEVLVPDFRGRLDKALDILQACPPDVMNHNMETVPRLYKQARPGADYEHSLKLLQEFKRRNPNVPTKSGLMVGLGETDEEILEVMRDMRAHDIDMLTIGQYLAPSNHHLPVLRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.979 kDa

MSDALIASSSEAPQSPAEQYDPTRKQKSADKTARIPIKIVPAEKLKKPDWIRVKAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYVDCISQTRELSPATRIEVLVPDFRGRLDKALDILQACPPDVMNHNMETVPRLYKQARPGADYAHSLKLLQEFKRRNPNVPTKSGLMVGLGETDEEILEVMRDMRAHDIDMLTIGQYLAPSNHHLPVLRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.8 kDa

MTAATAPDGRRMLRLEVRNAETPIERKPGWIKTTARMGPEYQALQQLVKTEDLHTVCQEAACPNIYECWEDREATFLIGGSQCTRRCDFCQIDTGKPADYDTDEPRRVADSVRRMGLRYATVTGVARDDLPDEGAWLHAETVRRIHADNPGTGVEILATDFSGNPDLLAEVFSSRPEVFAHNVETVPRIFKRIRPAFRYERSLDVITQARDAGLITKSNLILGMGETRDEVSEALVDLHDAGCDIITVTQYLRPSPRHLPVARWVRPEEFVEIKAEAEAIGFLGVLAGPLVRSSYRAGRLYAQSMRAKGRELPEGLAHLADPANGFAQAVG

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.573 kDa

MPTLKGIPVVTSGMKVERDGVRAIKDGVKHNPRAEAAPRGRKPSWLRARVPSGEGYQAVRDIVRTHRLSTVCEESHCPNIGECWNAGTATIMLMGAVCTRACRFCAVDTGNPKGRLDHDEPAHAADSVRLMGLSYVVLTSVDRDDLEDGGAGHYAACVNAIREVNPETAVEVLTPDFNGVPEHVHRVVDARPEVFAQNVETVRRLTHPVRDPRAGYEQTLEVLRLAKARRPDMLTKTSLMLGLGERDEEIRETLEDLRAVGVDIVTFGQYLQPTRNHLPVERYVSPAEFADYRRMGLEMGFLEVVAGPMVRSSYRADKVLEKNNVGLESAS

lipA

Lipoyl synthase

331 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.037 kDa

MTQQDPSTKEPKFIKNGIYRKDSVPVREKKPEWLKVTIPTGQVFTEVRKIVKEHRLHTVCEEAMCPNIGECWSRGTATFMLMGHICTRACRFCAVDTGNPMGKLDLDEPRSVADSVRLMDLKYVVLTSVDRDDLPDGGAYHFAKTVKAIKEVNPQTRVEALTPDFGGNTACVDLVLDSGVDTYAQNLETVRRLTHPVRDIRASYDRTLSVLAHAKQARPDVITKTSLMLGLGETREEIREAMADCRAAGVDVLTFGQYLRPTMHHLPVERYISPAEFDEIREEGMQLGFLEVVSGPLVRSSYKAEQIVMDRPGNLPEHLSHLDGGSELTLI

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.442 kDa

MTTATGTKPKKMEAFKMERGVKYRDAAKTSVIQVRNIDPDQELLPKPSWMKIKLPAASAKIDSIKHGMRRHGLHSVCEEASCPNLHECFNHGTATFMIMGAICTRRCPFCDVAHGKPLPLDPEEPRKVAETVQDMKLKYVVITSVDRDDLADRGAAHFAATVREIKALNPECKVEILVPDFRGRVEQAVEILKQNPPDVFNHNLENVPRLYREVRPGADYKWSLELLKIFKQEFPNIPTKSGLMVGLGETNEEILEVMQDLRDHGVTMLTIGQYLQPSRHHLKVERYVPPEEFDMFRSEAERMGFEHAACGPFVRSSYHADLQAKGELVK

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.442 kDa

MTTATGTKPKKMEAFKMERGVKYRDAAKTSVIQVRNIDPDQELLPKPSWMKIKLPAASAKIDSIKHGMRRHGLHSVCEEASCPNLHECFNHGTATFMIMGAICTRRCPFCDVAHGKPLPLDPEEPRKVAETVQDMKLKYVVITSVDRDDLADRGAAHFAATVREIKALNPECKVEILVPDFRGRVEQAVEILKQNPPDVFNHNLENVPRLYREVRPGADYKWSLELLKIFKQEFPNIPTKSGLMVGLGETNEEILEVMQDLRDHGVTMLTIGQYLQPSRHHLKVERYVPPEEFDMFRSEAERMGFEHAACGPFVRSSYHADLQAKGELVK

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.442 kDa

MTTATGTKPKKMEAFKMERGVKYRDAAKTSVIQVRNIDPDQELLPKPSWMKIKLPAASAKIDSIKHGMRRHGLHSVCEEASCPNLHECFNHGTATFMIMGAICTRRCPFCDVAHGKPLPLDPEEPRKVAETVQDMKLKYVVITSVDRDDLADRGAAHFAATVREIKALNPECKVEILVPDFRGRVEQAVEILKQNPPDVFNHNLENVPRLYREVRPGADYKWSLELLKIFKQEFPNIPTKSGLMVGLGETNEEILEVMQDLRDHGVTMLTIGQYLQPSRHHLKVERYVPPEEFDMFRSEAERMGFEHAACGPFVRSSYHADLQAKGELVK

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.442 kDa

MTTATGTKPKKMEAFKMERGVKYRDAAKTSVIQVRNIDPDQELLPKPSWMKIKLPAASAKIDSIKHGMRRHGLHSVCEEASCPNLHECFNHGTATFMIMGAICTRRCPFCDVAHGKPLPLDPEEPRKVAETVQDMKLKYVVITSVDRDDLADRGAAHFAATVREIKALNPECKVEILVPDFRGRVEQAVEILKQNPPDVFNHNLENVPRLYREVRPGADYKWSLELLKIFKQEFPNIPTKSGLMVGLGETNEEILEVMQDLRDHGVTMLTIGQYLQPSRHHLKVERYVPPEEFDMFRSEAERMGFEHAACGPFVRSSYHADLQAKGELVK

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.884 kDa

MSDAPIATSSEVTQSPADYDPTKKQKSAEKTARIPIKIVPAEKLKKPDWIRVKAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDVNEPGNLARTIAQLKLNYVVITSVDRDDLRDGGAQHYVDCISQTRELSPNTRIEVLVPDFRGRLDRALDILQACPPDVMNHNMETVPRLYKQARPGADYAHSLKLLQDFKRRNPNVPTKSGLMVGLGETDEEILDVMRDMRAHDIDMLTIGQYLAPSNHHLPVTRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHQAGFA

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.521 kDa

MSVEADGRKLLRVEVKNSQTPIENKPHWIKTRATMGPEYRDMRRRMIDGDLHTVCQEAGCPNIFECWEDREATFLIGGDHCTRRCDFCQIESAKPEGYDKDEPRRVAESVKQMGLRYATVTSVCRDDLEDEGAWLCAETIRQIHQVTPGVGVEMLAQDFSGKQDLLDIVFEARPEVFGHNLETVPRIFKRIRPGFRYDRSLAVLDSAHEAGLITKSNLILGMGETREEISQAMRALHDANTDLLTITQYLRPNSYLHPIDRWVTPQEFDELAEEAREIGFVGVMSGPLVRSSYRAGRLYRQAMEARGERPVMIVTGYRDGAKPAPFAAKE

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.458 kDa

MTTATGTKPKKMEAFKMERGVKYRDAAKTSVIQVRNIDPDQELLPKPSWMKIKLPAASAKIDSIKHGMRRHGLHSVCEEASCPNLHECFNHGTATFMIMGAICTRRCPFCDVAHGKPLPLDLEEPRKVAETVQDMKLKYVVITSVDRDDLADRGAAHFAATVREIKALNPECKVEILVPDFRGRVEQAVEILKQNPPDVFNHNLENVPRLYREVRPGADYKWSLELLKIFKQEFPNIPTKSGLMVGLGETNEEILEVMQDLRDHGVTMLTIGQYLQPSRHHLKVERYVPPEEFDMFRSEAERMGFEHAACGPFVRSSYHADLQAKGELVK

lipA

Lipoyl synthase

330 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.512 kDa

MTTAIGKKTTKLEPFKMERGVKYRDAAKTSVIQVRNIDPDQELLKKPEWMKIKLPTNSAKIDSIKYGMRRHGLHSVCEEASCPNLHECFNHGTATFMIMGAICTRRCPFCDVAHGKPLPLDPYEPRKVAETVQDMKLKYVVITSVDRDDLADRGAAHFAATVREIKALNPECKVEILVPDFRGRVEQAVAILKQNPPDVFNHNLENVPRLYREIRPGADYKWSLELLKIFKQEFPNIPTKSGLMVGLGETNEEILAVMQDLRDHGVTMLTVGQYLQPSRHHLRVERYVPPAEFEMFRSEAEKMGFEHAACGPFVRSSYHADLQAKGELVK

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.742 kDa

MGKLIDIPIVVESGQKYKTSQGVTAIKDGIKSSGQDHERLPKPKWLRIVNHTTPAYSQVKEQVQKHRLATVCEEAKCPNISECWSHGTATIMLMGAVCTRACRFCSVDTGNPHGWLDAEEPENTAETVALMNLDYVVLTSVNRDDLPDGGANHYAKTIRAIKKRSPRTKVEALTPDFQGSERDVAVLLDSGVDVFAQNVETVERLTHPVRDNRAGYQQTLNVLAFAKKYRPDVLTKTSLMLGLGETDEEIIQTMDDLRTHHVDILTLGQYLQPTKNHLPIARYVTPETFSELRQIGLKKGFFEVASGPLVRSSYRADRVFKRDNLGLDV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.77 kDa

MGKLIDIPIVVESGQKYKTSQGVTAIKDGIKSSGQDHERLPKPKWLRIVNHTTPAYSQVKEQVQKHRLATVCEEAKCPNISECWSHGTATIMLMGAVCTRACRFCSVDTGNPHGWLDAEEPENTAETVALMNLDYVVLTSVNRDDLPDGGANHYAKTIRAIKKRSPRTKVEALTPDFQGSERDVAVLLDSGVDVFAQNVETVERLTHPVRDNRAGYQQTLNVLAFAKKYRPDVLTKTSLMLGLGETDEEIIRTMDDLRTHHVDILTLGQYLQPTKNHLPIARYVTPETFSELRQIGLKKGFFEVASGPLVRSSYRADRVFKRDNLGLDV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.742 kDa

MGKLIDIPIVVESGQKYKTSQGVTAIKDGIKSSGQDHERLPKPKWLRIVNHTTPAYSQVKEQVQKHRLATVCEEAKCPNISECWSHGTATIMLMGAVCTRACRFCSVDTGNPHGWLDAEEPENTAETVALMNLDYVVLTSVNRDDLPDGGANHYAKTIRAIKKRSPRTKVEALTPDFQGSERDVAVLLDSGVDVFAQNVETVERLTHPVRDNRAGYQQTLNVLAFAKKYRPDVLTKTSLMLGLGETDEEIIQTMDDLRTHHVDILTLGQYLQPTKNHLPIARYVTPETFSELRQIGLKKGFFEVASGPLVRSSYRADRVFKRDNLGLDV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.754 kDa

MGKLIDIPIVVESGQKYKTSQGVTAIKDGIKSSGQDHERLPKPKWLRIVNHTTPAYSQVKEQVQKHRLATVCEEAKCPNISECWSHGTATIMLMGAVCTRACRFCSVDTGNPHGWLDAEEPENTAETVALMNLDYVVLTSVNRDDLPDGGANHYAKTIRAIKKRSPRTKVEALTPDFQGSERDVAVLLDSGLDVFAQNVETVERLTHPVRDNRAGYQQTLNVLAFAKKYRPDVLTKTSLMLGLGETDEEIIRTMDDLRAHHVDILTLGQYLQPTKNHLPIARYVTPETFSELRQIGLKKGFFEVASGPLVRSSYRADRVFKRDNLGLDV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.039 kDa

MSAEPEGRRMLRLEVRNAQTPIERKPEWIKTRATMGPEYRQLHSLVKSEGLHTVCQEAGCPNIYECWEDREATFLIGGSQCTRRCDFCQIDTGKPAEFDRDEPRRVAESVARMGLRYSTVTGVARDDLEDEGAWLYAETIREIHRQSPGTGVEILVPDFSGDPELLGEVFGARPEVFAHNVETVPRIFKRIRPAFRYERSLDVIAQGRAAGLITKSNLILGMGEERQEISQALQDLHDAGTDIITITQYLRPSPRHLPVARWVRPDEFVELRDEAEAIGFLGVLAGPLVRSSYRAGRLWAQSMRAKGRTVPEELRHLADASLGFAQAVS

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.039 kDa

MSAEPEGRRMLRLEVRNAQTPIERKPEWIKTRATMGPEYRQLHSLVKSEGLHTVCQEAGCPNIYECWEDREATFLIGGSQCTRRCDFCQIDTGKPAEFDRDEPRRVAESVARMGLRYSTVTGVARDDLEDEGAWLYAETIREIHRQSPGTGVEILVPDFSGDPELLGEVFGARPEVFAHNVETVPRIFKRIRPAFRYERSLDVIAQGRAAGLITKSNLILGMGEERQEISQALQDLHDAGTDIITITQYLRPSPRHLPVARWVRPDEFVELRDEAEAIGFLGVLAGPLVRSSYRAGRLWAQSMRAKGRTVPEELRHLADASLGFAQAVS

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.659 kDa

MSAAPEGRRMLRLEVRNAETPIERKPEWIKTKARMGPEYQALQQLVKTEDLHTVCQEAACPNIYECWEDREATFLIGGSQCTRRCDFCQIDTGKPADYDTDEPRRVADSVRRMGLRYATVTGVARDDLPDEGAWLHAETVRRIHADNPGTGVEILATDFSGNPDLLAEVFSSRPEVFAHNVETVPRIFKRIRPAFRYERSLDVITQGRDADLITKSNLILGMGETREEVSEALADLHDAGCDIITVTQYLRPSPRHLPVARWVRPEEFVEIKAEAEAIGFLGVLAGPLVRSSYRAGRLYAQSMSAKGRELPASLAHLADPANGFAQAVG

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.459 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATSSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.459 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATSSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.459 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATSSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.459 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATSSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.429 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.429 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.429 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.429 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALAILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

329 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.487 kDa

MTDLTATPAPAEPAASAYDPTAKQKAQAKTARIPIKIVPIEKLKKPEWIRVKAATGSSRFNEIKTILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDADEPKNLARTIAALKLKYVVITSVDRDDLRDGGAGHFVECIREVREQSPATRIEILTPDFRGRLDRALEILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHPDVATKSGLMVGLGETTDEILQVMRDLRAHDVDMLTIGQYLQPSEHHLPVREYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV

lipA

Lipoyl synthase

328 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.964 kDa

MSAVAPDGRKMLRLEVRNAQTPIERKPEWIKTRAKMGPEYTKMQNLVKSEGLHTVCQEAGCPNIYECWEDREATFLIGGDQCTRRCDFCQIDTGKPEALDRDEPRRVGESVVTMDLNYATITGVARDDLEDGGAWLYAETVRQIHAQTAGREAGRTKVELLAPDFNAEPDQLAEVFSARPEVFAHNVETVPRIFKRIRPGFRYERSLKVITEARDYGLVTKSNLILGMGETREEVSEALRQLHDAGCELITITQYLRPSVRHHPVERWVKPHEFVELKEEAEEIGFSGVMSGPLVRSSYRAGRLYQMAMELRQSAAPQGGAQVASQAV

lipA

Lipoyl synthase

328 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.964 kDa

MSAVAPDGRKMLRLEVRNAQTPIERKPEWIKTRAKMGPEYTKMQNLVKSEGLHTVCQEAGCPNIYECWEDREATFLIGGDQCTRRCDFCQIDTGKPEALDRDEPRRVGESVVTMDLNYATITGVARDDLEDGGAWLYAETVRQIHAQTAGREAGRTKVELLAPDFNAEPDQLAEVFSARPEVFAHNVETVPRIFKRIRPGFRYERSLKVITEARDYGLVTKSNLILGMGETREEVSEALRQLHDAGCELITITQYLRPSVRHHPVERWVKPHEFVELKEEAEEIGFSGVMSGPLVRSSYRAGRLYQMAMELRQSAAPQGGAQVASQAV

lipA

Lipoyl synthase

328 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.707 kDa

MSNDLTSESKTANRAAGEKFRDADKLAHIPIKVVSSTKATMLRKPSWLRIKLPKSSERIDNIKANLRKNDLHSVCEEASCPNLSECFNHGTATFMILGDICTRRCPFCDVGHGRPLAPKSDEPKKLANSLKDMGLKYVVITSVDRDDLRDGGAQQFADCVKEIGEQAPNTKVEILVPDFRGRMDRALEILNQNPPHVFNHNMETAPRLYTKVRPGANYQWSLDLLKRFGEANPDVTTKSGLMVGLGETNEEILEVMQDLRDHGVTMLTVGQYLQPSKDHLAVERYVHPDDFAMFEREAKKMGYEHAACGPLVRSSYHADKQAAGEEVK

lipA

Lipoyl synthase

328 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.363 kDa

MSAVAPEGRPLLRLEARNAQTPIERKPPWIRTRMRTGPEYSDVKGLVRAAGLHTVCEEAGCPNIYECWEDREATFLIGGDVCTRRCDFCQIDSGRPTPLDRDEPRRVAESVRTMGLRYATVTGVARDDLADGGSWLYGETVRQIHALSAGTGVEVLIPDFGGRADQLDEVFGAAPEVLAHNLETVPRIFKRIRPAFRYERSLDVLRQARAAGLVTKSNLILGLGETAEEIHAAMRDLHAAGCELLTVTQYLRPTPRHHPVERWVRPEEFLDWERVGAELGFSGVMSGPLVRSSYRAGRLYQQAITARGEGHTAASDLPKSVLETSHTQ

lipA

Lipoyl synthase

328 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.762 kDa

MTQQAKEPKFIKNGIYRKDAVPVRDKKPEWLKVTIPTGQVYGEVRKIVKEHRLHTVCEEAMCPNIGECWSRGTATFMLMGHICTRACRFCAVDTGNPMGKLDLEEPAHVAESVRLMGLKYVVLTSVDRDDLPDGGAYHFAKTVTAIKRENPGTRVEALTPDFGGNPHCVDLVLESGVDVYAQNLETVRRLTHPVRDIRASYERTLGVLKHAKQSRPDVITKTSIMLGLGETREELREAMLDCRAHGVDVITFGQYLRPTMHHLPVERYVSPAEFDEIREEGLSLGFLEVVAGPLVRSSYKAEQIVMDKPGNLPEHLAHLEGKEQLSLI

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.638 kDa

MSTTEVVRDAQSAENYNPLAKQKAAAKLSRIPVKVVQQGEVLKKPEWIRVKAGSPTTRFYEIKQILRESNLHTVCEEASCPNIGECFGNGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKDEPLNLAKTIAKLRLKYVVITSVDRDDLRDGGSQHFVDCITNIRELSPMTQIEILVPDFRGRDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLNLLKKFKALHPQVPTKSGIMVGLGETDEEILQVMRDMRAHDIDMLTIGQYLSPSGSHLPVRRYVHPDTFKMFEEEAYKMGFSHAAVGAMVRSSYHADQQAHAAGV

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.245 kDa

MAVVLDTLKNDPRPVRLRHPEKAHRPDQPVQAKKPDWIRVKAPGSRAWSETQKIVREHGLVTVCEEAGCPNIGECWEKRHATFMIMGDTCTRACAFCNVRTGLPDALDLGEPDKIADSVAKLGLHHVVITSVDRDDLRDGGAEHFARTIAAIRRASPGTTVEILTPDFLRKDGALEVVVAAKPDVFNHNLETVPAKYLTVRPGARYFHSVRLLQRVKELDPAIFTKSGIMVGLGEERNEVLQLMDDLRSADVDFLTIGQYLQPSKKHHEVVRFVPPDEFKAYETTAYAKGFLLVSATPLTRSSHHAGEDFARLQAARLAKLSPALSA

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.092 kDa

MKEISNIKVKIESGTKYTTDHGFHAVKDGIRNKKENSVHIRKPEWLKVKKQDSKEYLKVKSITKKHRLSTVCEEAKCPNINECWSHGTATIMLMGAVCTRACKFCSVDTGNPKGWLDKEEPQNTAESVKLMNLEYVVLTSVDRDDLVDGGAGHYAATITAIKNLDENIKVEALTPDFAGVKENVDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLEFLRYVKQKSPNILTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRRVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.84 kDa

MKEISGIKVKVESGSKYTTDHGFHAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.866 kDa

MKEISGIKVKVESGSKYTTDHGFYAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.866 kDa

MKEISGIKVKVESGSKYTTDHGFYAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.854 kDa

MKEISGIKVKVESGSKYTTDHGFHAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGIDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.84 kDa

MKEISGIKVKVESGSKYTTDHGFHAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.866 kDa

MKEISGIKVKVESGSKYTTDHGFYAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.84 kDa

MKEISGIKVKVESGSKYTTDHGFHAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.84 kDa

MKEISGIKVKVESGSKYTTDHGFHAVKDGIRNKKENAVHVRKPDWLKVQKQDSKEYLKVKSITKKHKLSTVCEEARCPNINECWSHGTATIMLMGSVCTRACKFCSVDTGNPKGWLDKDEPMNAAESVKLMGLEYVVLTSVDRDDLEDGGAGHYAATITAIKNLDENIKVEALTPDFAGINENIDKIINTKVDVIAQNIETVERLTHPVRDPRAGYWQTLNFLKYVKQKSPNVLTKTSIMVGLGETDEEIYKTMDDARSVGVDIITLGQYMQPTKHHLSVERFVTPQQFEEYRKVGLEKGFLEVASGPMVRSSYRADRVFKRNNLDL

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.775 kDa

MSTVVEKSGEAKPGKVEVGVKLRGAEKVARIPVKIIPTEELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVDEPTNLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCLREIRKLSPGIQLETLVPDYRGRMDIALEITANEPPDVFNHNLETVPRLYRSSRPGSDFEWSLDLLQKFKQMVPHVPTKSGLMLGLGETDEEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGERMGFKNVASGPLVRSSYHADQQAHGNKIG

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.733 kDa

MSTVVEKSGEAKPGKVEVGVKLRGAEKVARIPVKIIPTEELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVDEPTNLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCLREIRKLSPGIQLETLVPDYRGRMDIALEITANEPPDVFNHNLETVPRLYRSSRPGSDFEWSLDLLQKFKQMVPHVPTKSGLMLGLGETDDEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGEKMGFKNVASGPLVRSSYHADQQAHGNKIG

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.733 kDa

MSTVVEKSGEAKPGKVEVGVKLRGAEKVARIPVKIIPTEELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVDEPTNLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCLREIRKLSPGIQLETLVPDYRGRMDIALEITANEPPDVFNHNLETVPRLYRSSRPGSDFEWSLDLLQKFKQMVPHVPTKSGLMLGLGETDDEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGEKMGFKNVASGPLVRSSYHADQQAHGNKIG

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.733 kDa

MSTVVEKSGEAKPGKVEVGVKLRGAEKVARIPVKIIPTEELPKKPDWIRVRIPVSPEVDRIKQLLRKHKLHSVCEEASCPNLGECFSGGTATFMIMGDICTRRCPFCDVGHGRPKPLDVDEPTNLAIAIADLRLKYVVITSVDRDDLRDGGAQHFADCLREIRKLSPGIQLETLVPDYRGRMDIALEITANEPPDVFNHNLETVPRLYRSSRPGSDFEWSLDLLQKFKQMVPHVPTKSGLMLGLGETDDEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGEKMGFKNVASGPLVRSSYHADQQAHGNKIG

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.047 kDa

MSEIKTDDPKRGIKLRGADKTARIPIKVVPLQEKLKKPEWIRAKLPSRKFFEIKDILREQKMHTVCEEASCPNIGECFSKGTATFMIMGDICTRRCPFCDVGHGRPNMLDPDEPKNLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKIEILVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPGANYQHSLDLLKRYKEMMPHIPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFKIFEKEAYELGFTNAAIGAMVRSSYHADEQAAEALRESHGGCGHH

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.047 kDa

MSEIKTDDPKRGIKLRGADKTARIPIKVVPLQEKLKKPEWIRAKLPSRKFFEIKDILREQKMHTVCEEASCPNIGECFSKGTATFMIMGDICTRRCPFCDVGHGRPNMLDPDEPKNLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKIEILVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPGANYQHSLDLLKRYKEMMPHIPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFKIFEKEAYELGFTNAAIGAMVRSSYHADEQAAEALRESHGGCGHH

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.033 kDa

MSEIKTDDPKRGIKLRGADKTARIPIKVVPLQEKLKKPEWIRAKLPSRKFFEIKDILREQKMHTVCEEASCPNIGECFSKGTATFMIMGDICTRRCPFCDVGHGRPNMLDPDEPKNLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKIEILVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPGANYQHSLDLLKRYKEMMPHIPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFKIFEKEAYELGFSNAAIGAMVRSSYHADEQAAEALRESHGGCGHH

lipA

Lipoyl synthase

327 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.061 kDa

MSEIKTDDPKRGIKLRGADKTARIPIKVVPLQEKLKKPEWIRAKLPSRKFFEIKDILREQKMHTVCEEASCPNIGECFSKGTATFMIMGDICTRRCPFCDVGHGRPNMLDPDEPRNLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKIEILVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPGANYQHSLDLLKRYKEMMPHIPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFKIFEKEAYELGFSNAAIGAMVRSSYHADEQAAEALRESHGGCGHH

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.542 kDa

MSTPDVVREAQSTEAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPEWIRVKAGSPTTRFYEIKNILREHKLHTVCEEASCPNIGECFGRGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKDEPLNLAKTIAALRLKYVVITSVDRDDLRDGGSGHFVECIQRTRELSPSTQIEILTPDFRGRDDRALEILKAAPPDVMNHNLETVPRLYKEARPGSDYQFSLNLLKKFKQLHPGVPTKSGLMVGLGETDEEILEVMRDMRAHGIEMLTIGQYLAPSNSHLPVRRYVHPDTFKMFEEEAYKMGFSHAAVGAMVRSSYHADQQAHAAGV

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.542 kDa

MSTPDVVREAQSTEAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPEWIRVKAGSPTTRFYEIKNILREHKLHTVCEEASCPNIGECFGRGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKDEPLNLAKTIAALRLKYVVITSVDRDDLRDGGSGHFVECIQRTRELSPSTQIEILTPDFRGRDDRALEILKAAPPDVMNHNLETVPRLYKEARPGSDYQFSLNLLKKFKQLHPGVPTKSGLMVGLGETDEEILEVMRDMRAHGIEMLTIGQYLAPSNSHLPVRRYVHPDTFKMFEEEAYKMGFSHAAVGAMVRSSYHADQQAHAAGV

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.542 kDa

MSTPDVVREAQSTEAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPEWIRVKAGSPTTRFYEIKNILREHKLHTVCEEASCPNIGECFGRGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKDEPLNLAKTIAALRLKYVVITSVDRDDLRDGGSGHFVECIQRTRELSPSTQIEILTPDFRGRDDRALEILKAAPPDVMNHNLETVPRLYKEARPGSDYQFSLNLLKKFKQLHPGVPTKSGLMVGLGETDEEILEVMRDMRAHGIEMLTIGQYLAPSNSHLPVRRYVHPDTFKMFEEEAYKMGFSHAAVGAMVRSSYHADQQAHAAGV

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.542 kDa

MSTPDVVREAQSTEAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPEWIRVKAGSPTTRFYEIKNILREHKLHTVCEEASCPNIGECFGRGTATFMIMGDKCTRRCPFCDVGHGRPDPLDKDEPLNLAKTIAALRLKYVVITSVDRDDLRDGGSGHFVECIQRTRELSPSTQIEILTPDFRGRDDRALEILKAAPPDVMNHNLETVPRLYKEARPGSDYQFSLNLLKKFKQLHPGVPTKSGLMVGLGETDEEILEVMRDMRAHGIEMLTIGQYLAPSNSHLPVRRYVHPDTFKMFEEEAYKMGFSHAAVGAMVRSSYHADQQAHAAGV

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

37.008 kDa

MSKPVRMEPGVKLRDGDKMALIPVKFMPDPNEEVLRKPDWMRIKLPPSSQKIEHIKSTLRKNKLHSVCEEASCPNLAECFNHGTATFMIMGAICTRRCPFCDVAHGRPLALDPDEPQKLALTIKEMGLKYVVITSVDRDDLRDGGAQHFADCIKQIREHSPQTRIEILTPDFRGRMEQALEVFRETPPDVFNHNLETAPRMYRVARPGADYKWSLELLRRIKEMHPHVPTKSGVMMGLGETNEEIVQVLKDLREHGVNMLTLGQYLQPSRHHLPVKRYVPPAEFDELKDVAMGLGFSHAACGPFVRSSYHADLQAKGEEVVGYKAK

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.512 kDa

MTTNTVVREAQSQAEYNPLAKQKAAAKLSRIPIKVEHGEALKKPDWIRVKAGSPTTRFYEIKDILRANKLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRPDPLDTNEPLNLAKTIAELRLKYVVITSVDRDDLRDGGSGHFVECIKNIRELSPLTQIEILVPDFRGRDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLNLLKKFKALHPKVPTKSGIMVGLGETDEEILQVMRDMRAHDIDMLTIGQYLAPSNSHLPVRRYVHPDTFKMFEEEAYKMGFTHAAVGAMVRSSYHADQQAHAAGV

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.515 kDa

MSAVAPDGRKMLRLEVRNSQTPIERKPEWIKTRAKMGPEYKQLQQLVKGEGLHTVCQEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPQALDRDEPRRVGESVVTMDLNYATITGVARDDLEDGGAWLYAETVRQIHTLTAEREAGATKVELLIPDFNAEPEQLAEVFSSRPEVLAHNVETVPRIFKRIRPGFRYERSLEVITRAREAGLITKSNLILGMGETREEVSEALQDLYDAGCELITITQYLRPSVRHHPVERWVKPHEFVELKDEADAIGYSGVMSGPLVRSSYRAGRLFQQAMEARGVAAAGSAQAAQAV

lipA

Lipoyl synthase

326 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.155 kDa

MVTRVLIDHRQGGRHEAGVRHPEKQHRPDNPSQPKPSWIRVKAPNHPVYHQTQALMRENRLTTVCEEAACPNIGECWSQRHATMMIMGDTCTRACSFCNVKTGLPHALDGDEPARVADAVARLGLRHVVITSVDRDDLNDGGAAHIAAVIKAVRLAAPETTIEVLTPDFLRKPGAAETVAEARPDVFNHNLETVPRLYPAIRPGARYFQSLRLLDQVKRLDPSIFTKSGLMVGLGEDRAEIAQVMDDLRIAEVDFITLGQYLQPTPKHAAVDRFVTPDEFSDYASMARSKGFLMVSSSPLTRSSYHADADFAALRAARMEQQQRIA

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.805 kDa

MPPLADASTETLSPAEQAAVRHPEKAHRPDQPIARKPDWIRVKAPGSPEWVETQKIVKEHKLVTVCEEAGCPNIGECWAKKHATFMIMGDTCTRACAFCNVKTGLPNGLDPHEPAHIADAVQKLGLSHVVITSVDRDDLADGGAEHFAQVIRAIREASPKTTIEVLTPDFLRKDGALEIVVAARPDVFNHNLETVPAKYLSVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGETRNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHAVEAFITPDEFAAYAEVANAKGFLLVSASPLTRSSHHAGEDFARLKAARLERLGR

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.161 kDa

MATVIDTLKARGSEDRAARHPEKQNRPDTPVLRKPEWLRVRAPGSGQYNETKGIVREHKLHTVCEEAACPNIGECWSQKHATMMIMGEICTRACAFCNVTTGLPTQLDPDEPRRVAEAVAKMGLKHVVITSVDRDDLLDGGARHFAEVVTSIRAAAPGTTIEILTPDFLRKDGAENVVIDSKPDVFNHNLETVPRLYLKIRPGARYYNSLRLLDRVKQRDPSQFTKSGLMVGLGETKEEVMQVMDDMRSAGVDFITIGQYLQPTRKHAAIDRFVTPEEFKAYEAIARAKGFLMVSSSPLTRSSHHAGEDFAKLQAARRALDARTA

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.161 kDa

MATVIDTLKARGSEDRAARHPEKQNRPDTPVLRKPEWLRVRAPGSGQYNETKGIVREHKLHTVCEEAACPNIGECWSQKHATMMIMGEICTRACAFCNVTTGLPTQLDPDEPRRVAEAVAKMGLKHVVITSVDRDDLLDGGARHFAEVVTSIRAAAPGTTIEILTPDFLRKDGAENVVIDSKPDVFNHNLETVPRLYLKIRPGARYYNSLRLLDRVKQRDPSQFTKSGLMVGLGETKEEVMQVMDDMRSAGVDFITIGQYLQPTRKHAAIDRFVTPEEFKAYEAIARAKGFLMVSSSPLTRSSHHAGEDFAKLQAARRALDARTA

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.878 kDa

MASDSDLLDTKPAETRHPEKAHRPDQPTLRKPDWIRVRAPGSPEWAATNKIVKEHKLVTVCEEAGCPNIGECWAKKHATFMIMGDTCTRACAFCNVKTGLPRALDRNEPQRVADAVAKLGLSHVVITSVDRDDLSDGGARHFAEVIAAIRSLSPKTTIEVLTPDFLRKPGALEIVVAAKPDVFNHNLETVAGKYLGVRPGARYFHSLRLLQRVKELDPTLFTKSGIMLGLGEERQEVLQLMDDLRSADVDFMTIGQYLQPTKKHHAVARFVTPEEFNSYAEIGRAKGFLLMSSSPLTRSSHHAGEDFARLKAKRQALAPCAEAGQ

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.147 kDa

MTVTPSGSNGAGSAAPEGRKLLRLEVRNAQTPIERKPPWIKTRARMGPEYKELKSLVKREGLHTVCEEAGCPNIFECWEDREATFLIGGEQCTRRCDFCQIDTGKPSELDRDEPRRVAESVQAMGLRYSTVTGVARDDLPDGGAWLYAETVREIKRLNPNTGVELLIPDFNGDPALLAQVFESRPEVLAHNVETVPRIFKRIRPAFRYERSLAVLTAARDDNLVTKSNLILGMGETPDEVRTALVDLHEAGCDIITITQYLRPSPRHHPVERWVKPEEFVEFAQFAEGLGFAGVLSGPLVRSSYRAGRLYAQAARLKPAATPPVS

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.147 kDa

MTVTPSGSNGAGSAAPEGRKLLRLEVRNAQTPIERKPPWIKTRARMGPEYKELKSLVKREGLHTVCEEAGCPNIFECWEDREATFLIGGEQCTRRCDFCQIDTGKPSELDRDEPRRVAESVQAMGLRYSTVTGVARDDLPDGGAWLYAETVREIKRLNPNTGVELLIPDFNGDPALLAQVFESRPEVLAHNVETVPRIFKRIRPAFRYERSLAVLTAARDDNLVTKSNLILGMGETPDEVRTALVDLHEAGCDIITITQYLRPSPRHHPVERWVKPEEFVEFAQFAEGLGFAGVLSGPLVRSSYRAGRLYAQAARLKPAATPPVS

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.147 kDa

MTVTPSGSNGAGSAAPEGRKLLRLEVRNAQTPIERKPPWIKTRARMGPEYKELKSLVKREGLHTVCEEAGCPNIFECWEDREATFLIGGEQCTRRCDFCQIDTGKPSELDRDEPRRVAESVQAMGLRYSTVTGVARDDLPDGGAWLYAETVREIKRLNPNTGVELLIPDFNGDPALLAQVFESRPEVLAHNVETVPRIFKRIRPAFRYERSLAVLTAARDDNLVTKSNLILGMGETPDEVRTALVDLHEAGCDIITITQYLRPSPRHHPVERWVKPEEFVEFAQFAEGLGFAGVLSGPLVRSSYRAGRLYAQAARLKPAATPPVS

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.867 kDa

MANLIDNTARSAASDARAARHPEKQKRADTPVLRKPDWIRVKAPLGKTFSETQKIVKDGGLVTVCEEAGCPNIGECWEQKHATFMILGDTCTRACSFCNVKTGLPAAVDTDEPRRVAEAVAQMGLNHVVITSVDRDDLDDGGAQHFVDVIEAIRAATPSTTIEILTPDFLRKPGAAEAVIDARPDVFNHNLETVPRLYLSIRPGARYFHSLRLLERVKDRDPAQFTKSGIMVGLGESKEEVMQVMDDMRSAGIDFLTIGQYLQPTRKHAAVDRFVHPDEFKAYETIARAKGFLMVSATPLTRSSHHAGDDFAKLRAAREQMMARG

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.464 kDa

MTEITERIVPPPRKVAGVKESSAEKMARIPIKIIPMPAMRKPEWIRMKVPDSARFREIKQVLRENNLHTVCEEASCPNIGECFSGGTATFMILGDICTRRCPFCDVSHGKPLPPDANEPENLGRTIAQMRLKYVVITSVDRDDLRDGGAQHFVDCIAAVRAHSPQIKVEILVPDFRGRLDRAIHILKAAPPDVMNHNLETVPRLYKEARPGSDYQNSLDLLKEFGKLHPEVPTKSGLMLGLGETDEEILDVMRDLRAHNVTMLTLGQYLQPSPHHLPVKRFVTPQRFAEFERQALAMGFTHAACGPMVRSSYHADHQAQQAGVNF

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.867 kDa

MANLIDNTARSAASDARAARHPEKQKRADTPVLRKPDWIRVKAPLGKTFSETQKIVKDGGLVTVCEEAGCPNIGECWEQKHATFMILGDTCTRACSFCNVKTGLPAAVDTDEPRRVAEAVAQMGLNHVVITSVDRDDLDDGGAQHFVDVIEAIRAATPSTTIEILTPDFLRKPGAAEAVIDARPDVFNHNLETVPRLYLSIRPGARYFHSLRLLERVKDRDPAQFTKSGIMVGLGESKEEVMQVMDDMRSAGIDFLTIGQYLQPTRKHAAVDRFVHPDEFKAYETIARAKGFLMVSATPLTRSSHHAGDDFAKLRAAREQMMARG

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.464 kDa

MTEITERIVPPPRKVAGVKESSAEKMARIPIKIIPMPAMRKPEWIRMKVPDSARFREIKQVLRENNLHTVCEEASCPNIGECFSGGTATFMILGDICTRRCPFCDVSHGKPLPPDANEPENLGRTIAQMRLKYVVITSVDRDDLRDGGAQHFVDCIAAVRAHSPQIKVEILVPDFRGRLDRAIHILKAAPPDVMNHNLETVPRLYKEARPGSDYQNSLDLLKEFGKLHPEVPTKSGLMLGLGETDEEILDVMRDLRAHNVTMLTLGQYLQPSPHHLPVKRFVTPQRFAEFERQALAMGFTHAACGPMVRSSYHADHQAQQAGVNF

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.346 kDa

MSTTETTGKSPAKVETGVKLRGAEKVARIPVKVIPTEELPRKPDWIRVRMPASPEVERIKQLLRQHKLHSVCEEASCPNLGECFAGGTATFMIMGDICTRRCPFCDVGHGRPNPLDPDEPKNLAVAVADLRLKYVVITSVDRDDLRDGGAQHFADCLREIRRLSPGTQLETLVPDYRGRMEIALDITAAEPPDVFNHNLETVPRLYKASRPGADFEWSLDLLEAFKKRVPAVPTKSGLMLGLGETDEEVIEVMKRMREHEIDMLTLGQYLQPSRNHLAVQRFVHPDTFAWFAEEGERMGFKNVTSGPLVRSSYHADQQAHGAKGD

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.458 kDa

MSEQAQAKRKVQIGDKLRGADKVRTIPMVNEETGYQRKPDWIRVRVPANGEIQRIKSLLRKQKLHTVCEEAACPNLPECFGGGTATFMIMGDICTRRCAFCDVGFGRPNALDAQEPLHLAESVENLGLNYVVITSVDRDDLADGGAEHFAECIRQVRALTPETRIEILTPDFRPCLDTAVEILAETAPDVFNHNIETVPELYKHIRPGARYQHSLDLLKRYKALRPDVSTKSGIMVGLGETFEQVINTIKDLRTHDVDMITIGQYLQPSKHHAPVDRFVHPDEFREYARVANELGFTSVASGPMVRSSYHADLQHKGVDVGLYKP

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.503 kDa

MSSVETAGKRPAKVEAGVKLRGAEKVARIPVKIIPTDELPKKPDWIRVRIPVSPEVDQIKQTLRKHKLHSVCEEASCPNLGECFSSGTATFMIMGDICTRRCPFCDVGHGRPNALDPDEPKNLAQAIADMRLKYVVITSVDRDDLRDGGAQHFADCLREIRKLSPSIQLETLVPDYRGRMEIALDITATEPPDVFNHNLETVPRLYKSSRPGSDFEWSLDLLEKFKQRVPGVPTKSGLMLGLGETDEEVIEVMQRMREHDIDMLTLGQYLQPSRNHLPVQRFVHPDTFAWFAEEGMKMGFKNVASGPLVRSSYHADQQAHGAKHD

lipA

Lipoyl synthase

325 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.757 kDa

MPIAPDRVRHPEKANRPDNPIQRKPEWLRVKAPTSPEYGETRSLMRGLRLNTVCEEAACPNIGECWKKKHATFMILGAVCTRACAFCNVATGRPDQLDPHEPEKVAEAVAHLKLEHIVVTSVDRDDLEDGGAGHFARTIRAIRAAAPGTTIEVLTPDFMKKKGAVETVVEARPDVFNHNLETAPRLYPTIRPGARYFTSLQLLARVKEIDPSMFTKSGIMVGLGETKEEVFQVMDDLRAADVDFMTIGQYLAPTPKHAKVDRFVTPDEFAGYVTVGRGKGFLMVASSPLTRSSYHAGADFERLRAAREAKLAGRPVAAPEATSAE

lipA

Lipoyl synthase

324 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.021 kDa

MNVAPEPGAAGAAAPQGRKLLRLEVRNAQTPIERKPPWIRTRARMGPEYTELKNLVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAPLDRDEPRRVAESVHTMGLRYATVTGVARDDLPDGGAWLYAETVRAIKELNPSTGVELLIPDFNGKADQLGEVFEARPEVLAHNVETVPRVFKRIRPAFTYQRSLDVLTAARQFGLVTKSNLILGMGETPEEVRTALVDLHDAGCDIITITQYLRPSPRHHPVERWVRPEEFVEFAQYAEGLGFAGVLAGPLVRSSYRAGRLYEQARSRNTSGASNSG

lipA

Lipoyl synthase

324 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.653 kDa

MAEPIIVKGQKQNAMGVKRKGAEKVRHVAADAEHFEQERLKKPSWIRAKMPTGPEVMRMKAMMREQKLHSVCEEASCPNLGECFRFGTASFMIMGDICTRRCPFCDVAHGRPRPLNPFEPRNLAQTVYNLGLAHVVITSVDRDDLRDGGAAHFAACIREIRRVSPKMTIEILTPDFRGRAELAVQILSATPPDVFNHNLETIPRFYDVVRPGANYERSLHLLRDYKKACPKKIITKSGLMVGLGEEIEEILQVMQDLRSHDVDMLTVGQYLQPSVHHLPVKRYYTPEEFDFLAQEGKKMGFLHVASGAMVRSSYHADRSAQTVL

lipA

Lipoyl synthase

324 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.021 kDa

MNVAPEPGAAGAAAPQGRKLLRLEVRNAQTPIERKPPWIRTRARMGPEYTELKNLVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAPLDRDEPRRVAESVHTMGLRYATVTGVARDDLPDGGAWLYAETVRAIKELNPSTGVELLIPDFNGKADQLGEVFEARPEVLAHNVETVPRVFKRIRPAFTYQRSLDVLTAARQFGLVTKSNLILGMGETPEEVRTALVDLHDAGCDIITITQYLRPSPRHHPVERWVRPEEFVEFAQYAEGLGFAGVLAGPLVRSSYRAGRLYEQARSRNTSGASNSG

lipA

Lipoyl synthase

324 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.03 kDa

MSQKTPSPPGELKRDIRALKGASKVARIPVKVEPTTERQRKPHWIRAKAPIGPEVLRLKGLLREHRLHTVCEEASCPNLGECFGHGTATFLIMGNICTRRCPFCDVAHGRPDPLDAEEPMHLAQAIGAMGLRHVVVTSVDRDDLRDGGAAHFTHCIQAIRTQSPQTRIEVLVPDFRGRMDRALEALTAGPPDIFNHNLETVPRLYKAVRPGADYLWSLRLLARFKEDHPTVPTKSGLMLGLGEELAEVEQVMKDLRDHGCDMLTLGQYLQPSLYHLPVRRFVTPEEFDGLGDKAREMGFTHVASGPMVRSSYHADRQAAGESVV

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.283 kDa

MVTVFDAVADRAQRVRHPEKAHRPDTEVLRKPDWIRVKAPTSKGYQETRSIVKSHNLVTVCEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGRPNALDLDEPVNVAKAVKQMGLSHVVITSVDRDDLEDGGAEHFERVIFAIREASPQTTIEILTPDFLRKPGALERVVAAKPDVFNHNLETVPSNYLTVRPGARYFHSIRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHKVEKFVTPDEFKSYETVAYTKGFLMVSSSPLTRSSHHAGDDFARLKAAREKKLLAAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.163 kDa

MTAVTPDGRKLLRIEARNAQVPIERKPAWIRTRARMGPQYHALKELVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDTCSRNCSFCQISSGRPQPLDRDEPRRVAESVARMGLRYATVTGVTRDDLDDEGAWLYAQTVREIHHAVPGCGVELLTPDFHGRPELLDEVFSARPEVFAHNIETVPRIFKSIRPGFRYERSLDVLRAAHDAGLVTKSNLILGLGETRQEIRAALADLRSAGCDLVTITQYLRPSIRHHPVVRWVEPAEFEELAAEARELGFAGVMSGPLVRSSYRAGRLYRAAIASRTDRRTDGATTQAPQTP

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.163 kDa

MTAVTPDGRKLLRIEARNAQVPIERKPAWIRTRARMGPQYHALKELVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDTCSRNCSFCQISSGRPQPLDRDEPRRVAESVARMGLRYATVTGVTRDDLDDEGAWLYAQTVREIHHAVPGCGVELLTPDFHGRPELLDEVFSARPEVFAHNIETVPRIFKSIRPGFRYERSLDVLRAAHDAGLVTKSNLILGLGETRQEIRAALADLRSAGCDLVTITQYLRPSIRHHPVVRWVEPAEFEELAAEARELGFAGVMSGPLVRSSYRAGRLYRAAIASRTDRRTDGATTQAPQTP

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.341 kDa

MVTILDRTSSDEKRIRHPEKAHRPDTEVMRKPEWIRVKAPTSKGYHETRELVRSHKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNVATGKPNALDMDEPENVAKAVKQMGLSHVVITSVDRDDLADGGAEHFEKVIWAIRAASPTTTIEILTPDFLKKPGALERVVAAKPDVFNHNMETVPGNYLTVRPGARYFHSVRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRSADVDFLTIGQYLQPTRKHHKVEAFVTPEEFKSYETVAYAKGFLMVSSSPLTRSSHHAGDDFERLRAAREKKLLAAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.223 kDa

MVTILDRINPDAKRVRHPEKAHRPDTEVLRKPDWIRVKAPTSKGYAETRSIVKEHKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNVATGKPNALDMAEPENIAKAVKEMGLSHVVITSVDRDDLADGGAEHFEKVIWAIRAASPMTTIEILTPDFLKKPGALERVVAAKPDVFNHNMETVPGNYLTVRPGARYFHSVRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHQVMSFVTPEEFKSYETVAYTKGFLMVASSPLTRSSHHAGDDFARLRAAREKKILLAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.458 kDa

MVTILDRTKPDDKRIRHPEKAHKPDTEVLRKPEWIRVKAPTSKGYQETRELVRSHKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNVATGKPNALDREEPANVAKAVRQMGLSHVVITSVDRDDLADGGAEHFEQVIWAIREASPATTIEILTPDFLKKPGALERVVAAKPDVFNHNMETVPGNYLTVRPGARYFHSVRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHKVERFVTPEEFKSYEDIAYTKGFLMVASSPLTRSSHHAGDDFARLKANREKKLLAAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.51 kDa

MMENSPKTRRLNILPDNPENTGDGVVGLGRFPSWLHRPLPKGNQLQITGQVINQNRLHTVCEEAKCPNLLECWTKKTATFLVMGKECSRNCGFCDIDFSKNPKPLDRSEPSRVALSVQQLGLKHVVITMVARDDLSDGGSSHLVEVIEAIRQTNEDVTIEVLTSDFEGNRKALSFVLQAKPEIFNHNIETVRRLTPRVRHKATYERTLSVLEQAAQKKYHSQLKVKSGIMVGLGETEEEIFETLLDLKRVGCEIVTIGQYLQPNRQKLLVKSFVHPDIFKKYEQYGLSIGIPHLYCGPFVRSSYNANLVLMRANQKEAIVNSE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.909 kDa

MKPKFETVELLSPTGEVVELKVVKRGLAQARPEPVDRNKPAWIKAPLPTGPRYQALKAMVRELRLHTVCQEALCPNIGECWTHGTLTVMILGDICTRACKFCAVHTGNPKGLVDPEEPRRVAEAIARMGVRYVVLTSVDRDDLPDGGASHFAATIRAIKERAPGVLVEALTPDFQGDLKAVETVLAANPEVYAQNLETVRRLTPKVRDPRAGYEQTLKVLAHAKKVRPDILTKSSLMLGLGETEEEILEAMRDLRAAGVDILTLGQYLRPTPAHLPVARYVPPEDFKRYEAWGYELGFREVFAGPLVRSSYRADRVFLEATQR

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.909 kDa

MKPKFETVELLSPTGEVVELKVVKRGLAQARPEPVDRNKPAWIKAPLPTGPRYQALKAMVRELRLHTVCQEALCPNIGECWTHGTLTVMILGDICTRACKFCAVHTGNPKGLVDPEEPRRVAEAIARMGVRYVVLTSVDRDDLPDGGASHFAATIRAIKERAPGVLVEALTPDFQGDLKAVETVLAANPEVYAQNLETVRRLTPKVRDPRAGYEQTLKVLAHAKKVRPDILTKSSLMLGLGETEEEILEAMRDLRAAGVDILTLGQYLRPTPAHLPVARYVPPEDFKRYEAWGYELGFREVFAGPLVRSSYRADRVFLEATQR

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.083 kDa

MVTILDTINPDAKRVRHPEKAHRPDTEVMRKPDWIRVKAPTSKGYAETRAIVKEHKLVTVCEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGKPNALDMAEPENVAKAVKEMGLSHVVITSVDRDDLEDGGAEHFEKVIWAIRAASPATTIEILTPDFLKKPGALERVVAAKPDVFNHNMETVAGNYLTVRPGARYFHSIRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHKVESFVTPDEFKSYETVAYSKGFLMVASSPLTRSSHHAGDDFARLRAAREKKLLVAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.218 kDa

MVTILDTINPDAKRVRHPEKAHRPDTEVMRKPDWIRVKAPTSKGYAETRAIVKEHKLVTVCEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGKPNALDMDEPENVAKAVREMGLSHVVITSVDRDDLEDGGAEHFEKVIWAIRSASPATTIEILTPDFLKKPGALERVVAAKPDVFNHNMETVAGNYLTVRPGARYFHSIRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHKVESFVTPEEFKSYETVAYSKGFLMVASSPLTRSSHHAGDDFARLRAAREKKLLMAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.188 kDa

MVTILDTINPDAKRVRHPEKAHRPDTEVMRKPDWIRVKAPTSKGYAETRAIVKEHKLVTVCEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGKPNALDMAEPENVAKAVKEMGLSHVVITSVDRDDLEDGGAEHFEKVIWAIRAASPMTTIEILTPDFLKKPGALERVVAAKPDVFNHNMETVPGNYLTVRPGARYFHSVRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHKVESFVTPDEFKSYETVAYSKGFLMVASSPLTRSSHHAGDDFARLRAAREKKLLMAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.142 kDa

MVTILDTINPDAKRVRHPEKAHRPDTEVMRKPDWIRVKAPTSKGYAETRAIVKEHKLVTVCEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGKPNALDMAEPENVAKAVKEMGLSHVVITSVDRDDLEDGGAEHFEKVIWAIRAASPATTIEILTPDFLKKPGALERVVAAKPDVFNHNMETVPGNYLTVRPGARYFHSIRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPTRKHHKVESFVTPDEFKSYETVAYSKGFLMVASSPLTRSSHHAGDDFARLRAAREKKLLMAAE

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.865 kDa

MKKNKDVLLKNKILKKLNIINIKNLDNIKEKLKKPDWIKIKIPVNTSRIYQIKNALRKNNLYSVCEEAHCPNLSECFNNGTATFMILGSICTRNCPFCAVFHGRPNPVNVEEPQKLSDTIFDMGINYVVITSVVRDDLYDGGAEHFVNCIKAIKNKNQVKIEILVPDFRGRIELILNIFNNALPDIFNHNIENVPRLYKKIRPGANYQRSLLLLESFKKKYCSVLTKSGLMLGLGEKDVEIIQVMKDLYSSGVTLLTVGQYLQPSIHHLPVKRYIPLSEFENIKKEALSIGFTNAFCGPFVRSSYHASFQSHLPIKNNDINNI

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.877 kDa

MKKNKDVLLKNKILKKLNIINIKNLDNIKEKLKKPDWIKIKIPVNTSRIYQIKNALRKNNLYSVCEEAHCPNLSECFNNGTATFMILGSICTRNCPFCAVFHGRPNPVNVEEPQKLSDTIFDMGINYVVITSVVRDDLYDGGAEHFVNCIKAIKNKNQVKIEILVPDFRGRIELILNIFNKALPDIFNHNIENVPRLFKKIRPGANYQRSLLLLESFKKKYCSVLTKSGLMLGLGEKDVEIIQVMKDLYSSGVTLLTVGQYLQPSIHHLPVKRYIPLSEFENIKKEALSIGFTNAFCGPFIRSSYHASFQSHLPIKNNDINNI

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.865 kDa

MKKNKDVLLKNKILKKLNIINIKNLDNIKEKLKKPDWIKIKIPVNTSRIYQIKNALRKNNLYSVCEEAHCPNLSECFNNGTATFMILGSICTRNCPFCAVFHGRPNPVNVEEPQKLSDTIFDMGINYVVITSVVRDDLYDGGAEHFVNCIKAIKNKNQVKIEILVPDFRGRIELILNIFNNALPDIFNHNIENVPRLYKKIRPGANYQRSLLLLESFKKKYCSVLTKSGLMLGLGEKDVEIIQVMKDLYSSGVTLLTVGQYLQPSIHHLPVKRYIPLSEFENIKKEALSIGFTNAFCGPFVRSSYHASFQSHLPIKNNDINNI

lipA

Lipoyl synthase

323 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.662 kDa

MSKIPAPDEKTSRSDSGSSILRKPDWLRVRSPGGAAFNETHGLIRKLGLATVCEEAACPNIGECWTKKQATVMILGEVCTRACAFCNVKTGHPDKVNPLEPGHVADVAAEMNLEHIVITSVDRDDLEDGGASQFVKVIEAVRARTPKTTIEILTPDFRGKPDHALDMIVKARPDVFNHNLETVPRLYPTIRPGARYFTSLRLLEKVRERDPSIFTKSGLMLGLGEDRLEVHQVMDDMRQADVDFLTLGQYLQPTPRHVRVEEFVTPDSFKAYAATARAKGFSMVASSPLTRSSYYAGADFARLKEARQKKLEKIAAKNSGKGA

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.444 kDa

MSKPVRVEPGVKMRDADKMALIPVQIIPTERDQMLRKPSWLKVKLPSSTERIDEIKQAMRSHGLHSVCEEASCPNLPECFNHGTASFMILGDICTRRCPFCDVAHGRPLPPDPEEAEKLGKTIRDMKVKYVVITSVDRDDLRDGGAQHFADCIREIREHSENNIQVEVLVPDFRGRMQVAIDILKGEAPDVFNHNLETVPRLYKAARPGANYQWSLDLLQKYKEVRPDIRTKSGLMVGLGETKEEILEVMKDLRAHDVDMLTIGQYLQPSRHHIPVARYVHPDEFEELRVAGVEMGFSHIASGPLVRSSYHADLQAAGETVR

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.963 kDa

MVTVLDTVSKPRPRHPEKAHRPDQEVLRKPDWIRVKAPTSRGYLETREIVKTNKLVTVCEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGIPGPLDPNEPANVAKAVREMGLNHVVITSVDRDDLNDGGAQHFADVIQAIRAATPQTTIEILTPDFLRKDGALELVVAAKPDVFNHNLETVPSKYLTVRPGARYFHSIRLLQRVKEIDPSIFTKSGIMVGLGEERNEVLQLMDDLRSADVDFITIGQYLQPTKKHHPVKKFVTPEEFKSYETIAYTKGFLMASSSPLTRSSHHAGEDFERLRAAREARLSLAKTA

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.702 kDa

MKTLDENQAPSRQTPESHRRGAEKLSRIPVKVEPGAPLRKPDWIRVRAGSGDEVRRVKRLLRERGLHSVCEEAACPNLAECFGHGTATFMILGDICTRRCPFCDVAHGRPAPPDPAEPERLAETIALLRLRYVVITSVDRDDLRDGGAAHFAACIRALRTRSPALSVEILTPDFRGRMEIALDLLAADPPDVFNHNIETVPRLYRQARPGADYRQSLELLARFRDKVPGVPTKSGLMLGLGETLDEVREALRDLRGHGCEMLTLGQYLQPSRDHLPVVRYVPPAEFDELAGYARELGFASVASAPLVRSSYHADQQAAIIGR

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.702 kDa

MKTLDENQAPSRQTPESHRRGAEKLSRIPVKVEPGAPLRKPDWIRVRAGSGDEVRRVKRLLRERGLHSVCEEAACPNLAECFGHGTATFMILGDICTRRCPFCDVAHGRPAPPDPAEPERLAETIALLRLRYVVITSVDRDDLRDGGAAHFAACIRALRTRSPALSVEILTPDFRGRMEIALDLLAADPPDVFNHNIETVPRLYRQARPGADYRQSLELLARFRDKVPGVPTKSGLMLGLGETLDEVREALRDLRGHGCEMLTLGQYLQPSRDHLPVVRYVPPAEFDELAGYARELGFASVASAPLVRSSYHADQQAAIIGR

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.335 kDa

MSKPIKIEQGIKYRDADKMALIPVRNVAEEAPKEVLRKPAWMKIKLPSDSKRIQEIKSALRKNKLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLPPNAEEPSHLAQTIADMKLKYVVITSVDRDDLRDGGAQHFVDCIREIREKSPEIHIETLVPDFRGRMDRALDILQGTPPNVFNHNLETAPRLYRKARPGANYQWSLDLLKNFKEIHPEVPTKSGVMMGLGETKEEIIQVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFDELKEIALELGFTHAACGPFVRSSYHADLQAQGLEIK

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.587 kDa

MVTLIDTISERQVRPRHPEKAHRPDAISPPKPDWIRVRAPTSRGYANTRNIVKENGLVTVCEEAGCPNIGECWDKKHATFMIMGDTCTRACAFCNVRTGLPDGLDPDEPAHVALAVQKLGLAHVVITSVDRDDLADGGAAHFAATIAAIRESCPTTTIEILTPDFLRKEGALEVVVAAKPDVFNHNLETVPSRYQSVRPGARYFHSVRLLQRVKEIDPTIFTKSGIMVGLGEERHEVLQVMDDLRSADVDFLTIGQYLQPTLKHHAVMRYVTPEEFDGYERIAFTKGFLMVSASPLTRSSHHAGEDFARLKAAREAKLQSAG

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.93 kDa

MSQRITIDHRSAPALRHPEKAHRPDNPIQRKPSWIRVKAPNHPVYHETRALMRDAGLVTVCEEAACPNIGECWSQRHATMMIMGEICTRACAFCNVTTGLPKHLDEDEPRRVGEAVAKLGLKHVVITSVDRDDLEDGGAMHFARVIHAIRETSPQTTIEILTPDFLRKDGALEVVVAARPDVFNHNIETIPRLYPTIRPGARYYQSVRLLDGVKKLDPSIFTKSGLMLGLGEERMEVAQVMDDFRIADVDFLTLGQYLQPSAKHAAVEKFVTPDEFDGYAAAARSKGFLQVSASPLTRSSYHADSDFAKLQAARNSRLKESL

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.03 kDa

MSNKPSQLTAGKKLRDADKMSHIPIKVVPSNKSTLLKKPSWMKIKLSSDNTRVNEIKAALRKNNLHSVCEEASCPNLNECFNHGTATFMILGDICTRRCPFCDVGHGKPLAVDANEPKKLAETIKDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRLLNPEIKIEILVPDFKGRMDKALACFEQDLPDVFNHNLETAPHLYKQVRPGADYKWSLKLLQKFKEKHPHIPTKSGLMVGLGETNEDIEQVLTDLRAHDVNMLTLGQYLQPSLDHLAVQRFVPPSEFDELGVKAKALGFDQAACGPLVRSSYHADLQASGQEVK

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.096 kDa

MVTVFDAVSDRAQRVRHPEKAHRPDTEVLRKPDWIRVKAPTSKGYQETRSIVKSHKLVTVCEEAGCPNIGECWDKKHATFMIMGEICTRACAFCNVATGKPNALDLDEPANVAKAVKQMGLSHVVITSVDRDDLDDGGAEHFEKVIFAIREASPETTIEILTPDFLRKPGALERVVAAKPDVINHNLETVPSNYLTVRPGARYFHSIRLLQRVKELDPTMFTKSGIMVGLGEERNEVLQLMDDLRTADVDFLTIGQYLQPSRKHHKVEKFVTPEEFKSYETVAYTKGFLMVSSSPLTRSSHHAGDDFARLKAARERKLAAAE

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.057 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIRECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.957 kDa

MVTVLNTVNQSGRLRHPEKAHRPDNEVLKKPDWIRVKAPVSRGYGETREIVRSNKLVTVCEEAGCPNIGECWEKKHATFMIMGEICTRACAFCNISTGIPNALDPNEPENIAKAVKQMGLTHVVITSVDRDDLADGGAHHFAEVIKAVREAAPATTIEILTPDFLRKEGALEIVVKARPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKELDPTIFTKSGIMVGLGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFVKPDEFKSFETIGKTKGFLLVASSPLTRSSHHAGEDFAKLKAAREALYASRAS

lipA

Lipoyl synthase

322 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.667 kDa

MSEIKTDDPKRGIKLRGADKTARIPIKVVPLQEKLKKPEWIRAKLPSRKFFEIKDILREQKMHTVCEEASCPNIGECFSKGTATFMIMGDICTRRCPFCDVGHGRPNMLDPDEPRNLAESVKAMNLRYVVITSVDRDDLRDGGAQHFADCIKAIRETSPNTKIEILVPDFRGRLDIALKILAETPPDVMNHNLETHPSLYRKARPGANYQHSLDLLKRYKEMMPHIPTKSGIMVGLGETDEDVREIMRDMRAHNIEMITIGQYLQPSDGHLPVLRYVTPEQFKIFEKEAYELGFSNAAIGAMVRSSYHADEQAAEALRECEF

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.091 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSSRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPQKLAQTIADMGLRYVVVTSVDRDDLRDGGAQHFADCISAIREKNPSIKIETLVPDFRGRMDRALDILTVTPPDVFNHNLENVPRLYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNDEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFEEMKAEAMAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.091 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSSRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPQKLAQTIADMGLRYVVVTSVDRDDLRDGGAQHFADCISAIREKNPSIKIETLVPDFRGRMDRALDILTVTPPDVFNHNLENVPRLYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNDEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFEEMKAEAMAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.468 kDa

MSKPIQMERGVKYRDADKMALIPIKNMPTEQKEVLRKPEWMKIKLPADSQRIQDIKAAMRKNNLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPNAPEAEEPKKLAQTIHDMKLKYVVITSVDRDDLRDGGAQHFADCNREIRALNPHIKIETLVPDFRGRMEVALEALKDNPPDVFNHNLETAPRLYRKVRPGANYKWSLELLRQFKEQHPHVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFDELKEIALELGFTHAACGPFVRSSYHADLQAKGLEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.433 kDa

MSKPIQMEKGVKYRDADKMALIPVKNMPSEQKEVLRKPDWMKIKLPADSQRIQDIKSAMRKNNLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLPVEAEEPKKLAKTIADMKLKYVVITSVDRDDLRDGGAEHFANCNREIRELNPHIKIETLVPDFRGRMDVALDLMKDNPPDVFNHNLETAPRLYRKARPGANYKWSLQLLQKFKEQHPNVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPSEFDELKEIALELGFTHAACGPFVRSSYHADMQAQGIEIK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.454 kDa

MSKPIQMERGVKYRDADKMALIPIKNMPTEQKEVLRKPEWMKIKLPADSQRIQDIKAAMRKNNLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPNAPEAEEPKKLAQTIHDMKLKYVVITSVDRDDLRDGGAQHFADCNREIRALNPHIKIETLVPDFRGRMEVALEALKDNPPDVFNHNLETAPRLYRKVRPGANYKWSLELLRQFKEQHPHVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFDELKEVALELGFTHAACGPFVRSSYHADLQAKGLEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.468 kDa

MSKPIQMERGVKYRDADKMALIPIKNMPTEQKEVLRKPEWMKIKLPADSQRIQDIKAAMRKNNLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPNAPEAEEPKKLAQTIHDMKLKYVVITSVDRDDLRDGGAQHFADCNREIRALNPHIKIETLVPDFRGRMEVALEALKDNPPDVFNHNLETAPRLYRKVRPGANYKWSLELLRQFKEQHPHVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFDELKEIALELGFTHAACGPFVRSSYHADLQAKGLEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.451 kDa

MSKPIQMEKGVKYRDADKMALIPVKNMPTEQKEVLRKPDWMKIKLPADSQRIQDIKAAMRKNKLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLPPEAEEPQKLARTIADMKLKYVVITSVDRDDLRDGGAQHFADCNREIRELNPDIKIETLVPDFRGRMDVALDLMKDNPPDVFNHNLETAPRLYRKARPGANYKWSLELLKKFKEQHPDVPTKSGLMMGLGETKEEIIEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPSEFDELKEVALELGFTHAACGPFVRSSYHADMQAQGLEIK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.548 kDa

MSKPIQMEKGVKYRDADKMALIPVKNMPAEQKEVLRKPAWMKIKLPSDSHRIQEIKSAMRKNNLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPNAPEAEEPKKLAKTIKDMKLKYVVITSVDRDDLRDGGAQHFADCNREIREQNPNIRIETLVPDFRGRMDVALELMKDNPPDVFNHNLETAPRLYRKARPGANYKWSLDLLRKFKEQHPNIPTKSGVMMGLGETKEEIVQVLKDLREHGVTMLTLGQYLAPSRHHLPVERYVPPSEFDELKEIALELGFTHAACGPFVRSSYHADLQAQGMEIK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.316 kDa

MSKPIQMEKGVKYRDADKMALIPVKNMPTEQKEVLRKPDWMKIKLPADSQRIQDIKSAMRKNNLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLPPEAEEPTKLAKTIADMKLKYVVITSVDRDDLRDGGAKHFADCNREIRAQSPHIRIETLVPDFRGRMDVALEALKDNPPDVFNHNLETAPRLYRKVRPGANYQWSLDLLKKFKEQHPDVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFDELKEIALELGFTHAACGPFVRSSYHADMQAQGLEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.316 kDa

MSKPIQMEKGVKYRDADKMALIPVKNMPTEQKEVLRKPDWMKIKLPADSQRIQDIKSAMRKNNLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLPPEAEEPTKLAKTIADMKLKYVVITSVDRDDLRDGGAKHFADCNREIRAQSPHIRIETLVPDFRGRMDVALEALKDNPPDVFNHNLETAPRLYRKVRPGANYQWSLDLLKKFKEQHPDVPTKSGLMMGLGETKEEIVEVLKDLRAHGVTMLTLGQYLAPSRHHLPVERYVPPAEFDELKEIALELGFTHAACGPFVRSSYHADMQAQGLEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.38 kDa

MNRPERLQPGVKLRDADKVSRIPVKVVPSERDTMLRKPDWLRVKLPASNQRITEIKQALRKNGLHSVCEEASCPNLSECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPKKLAQTIKDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRLLNPEIKIETLVPDFRGRIDKALDILAIEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKKFKERHPDIPTKSGLMMGLGESNEEIAQVLHDLRAHDVEMLTLGQYLQPSKFHLPVERYVSPAEFDELKDLAESIGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.465 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERETMLRKPDWLRVKLPASNQRILEIKQALRSNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPEIKIEILVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLREHKVEMLTLGQYLQPSKFHLPVERYVSPAEFDELKVLADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.437 kDa

MSRPERLQPGVKLRDADKVARIPVKVVPSERETMLRKPDWLRVKLPASSQRIDDIKKALRKNELHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDANEPKKMAQTIKDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRLLNPSIKIEILVPDFRGRIDAALDILATEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKKFKERHPDIPTKSGLMMGLGETNDQIAEVLKDLRAHNVEMLTLGQYLQPSKFHLRVERYVPPAEFDELREFAESIGFTHAACGPMVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.465 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERETMLRKPDWLRVKLPASNQRILEIKQALRSNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPEIKIEILVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLREHKVEMLTLGQYLQPSKFHLPVERYVSPAEFDELKVLADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.451 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERETMLRKPDWLRVKLPASNQRILEIKQALRSNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDADEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPEIKIEILVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLREHKVEMLTLGQYLQPSKFHLPVERYVSPAEFDELKVLADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.345 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERDTMLRKPDWLRVKLPASNQRILDIKQALRSNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPAIKIEILVPDFRGRIDAALDILATEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLREHKVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.349 kDa

MSRPERLQPGVKLRDADKVSRIPVKVVPSERETMLRKPDWLRVKLPSSSQRIDEIKQALRSNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAQEPKKLAQTIKDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRLLNPEIKIETLVPDFRGRIDAALDILATEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKKFKERHPDVPTKSGLMMGLGETNEEIAQVLKDLRAHNVEMLTLGQYLQPSKFHLPVERYVPPAEFDELRVFAEEIGFTHAACGPMVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.084 kDa

MSKPIVMERGVKYRDADKMALIPVKNVAIEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.072 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.072 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.072 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.072 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.072 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQIKIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.981 kDa

MSKPIQMERGVKYRDADKMALIPIKTVAVERQEILRKPSWMKIKLPADSTRIQGIKVAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVTPDANEPEKLAQTIADMGLRYVVVTSVDRDDLRDGGAQHFADCISAIRAKNPNIRIETLVPDFRGRMDRALEIINAAPPDVFNHNLENVPRLYRQVRPGADYHWSLKLLENFKVANPQLPTKSGLMVGLGETNAEIVDVMRDLCRHGVTMLTLGQYLQPSRHHLPVKRYVSPQEFDEMKQEALAMGFTHAACGPFVRSSYHADLQAKGIEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.961 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPSIKIETLVPDFRGRMDRALEILTATPPDVFNHNLENVPRLYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRAHGVTMLTLGQYLQPSRHHLPVQRYVSPDEFEEMKAEAMAMGFTHAACGPFVRSSYHADLQAKGEEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

35.998 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPCVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.157 kDa

MSKPIQMERGVKYRDADKMALIPVKTVVTERQELLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLSECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDANEPEKLAQTIADMGLRYVVITSVDRDDLRDGGAQHFADCIAAIRAKNPTIKIETLVPDFRGRMDRALEILTETPPDVFNHNLENVPRVYRQVRPGANYEWSLKLLERFKEAHPHIPTKSGLMVGLGETNAEIVEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPAEFDEMKEEAMAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.332 kDa

MNRPERLQPGVKLRDADKVARIPVKIMPSERETMLRKPDWLRVKLPASNQRITEIKQALRSNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDADEPVKLAKTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRALNPHIQIETLVPDFRGRIDVALDILSTNPPDVFNHNLETAPAHYRKARPGANYQWSLDLLKRFKERHPNIPTKSGLMMGLGETNEEIIQVLKDLRAHDVNMLTLGQYLQPSKFHLPVERYVSPQEFDELKVIAEDLGFSHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.376 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERDTMLRKPDWLRVKLPASNQRILEIKQALRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPDIKIETLVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLRAHNVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.376 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERDTMLRKPDWLRVKLPASNQRILEIKQALRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPDIKIETLVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLRAHNVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.376 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERDTMLRKPDWLRVKLPASNQRILEIKQALRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPDIKIETLVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNDEIAQVLRDLRAHKVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.376 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERDTMLRKPDWLRVKLPASNQRILEIKQALRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPDIKIETLVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLRAHNVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.313 kDa

MNRPERLQPGVKLRDADKVARIPVKIVPSERETMLRKPDWLRVKLPASNQRILEIKAALRKNGLHSVCEEASCPNLSECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPDIKIETLVPDFRGRIDAALDILSAEPPDVFNHNLETAPAHYRKARPGANYQWSLDLLKRFKERHPHIPTKSGLMMGLGETNEEIAEVLRDLRSHNVEMLTLGQYLQPSKFHLPVVRYVPPAEFDELKVLADELGFTHAACGPMVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.205 kDa

MNRPERLQPGVKLRDADKVARIPVKVVPSERETMLRKPDWLRVKLPSSNQRILEIKAALRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKADADEPKKLAQTIKDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRLLNPEIKIETLVPDFRGRIDAALDILATEPPDVFNHNLETAPAHYRKARPGANYQWSLDLLKRFKERHPTIPTKSGLMMGLGETNEEIAEVLRDLRAHNVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.366 kDa

MNRPERLQPGVKLRDAEKVSRIPVKVVPSERETMLRKPDWLRVKLPASNQRITDIKQALRKNGLHSVCEEASCPNLSECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPKKLAQTIKDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRLLNPEIKIETLVPDFRGRIDAALDILATEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKKFKERHPDIPTKSGLMMGLGESNEEIAQVLYDLRAHNVEMLTLGQYLQPSKFHLAVERYVSPAEFDELKELAESIGFTHAACGPLVRSSYHADLQAQGKEVR

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.45 kDa

MSRPERLQPGVKLRDADKVSRIPVKVVPSERETMLRKPDWLRVKLPASNQRIVDIKQALRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPEIKIEILVPDFRGRIDAALEILATEPPDVFNHNLETAPKHYRKARPGANYQWSLDLLKKFKEQHPHIPTKSGLMMGLGETNEEIAEVLRDLRAHNVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKDYAEEIGFTHAACGPMVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.464 kDa

MNRPERLQPGVKLRDAEKVSRIPVKIVPSERETMLRKPDWLRVKLPASNQRILDIKQALRANGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDEQEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPEIKIEILVPDFRGRIDAALDILSTEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNDEIAQVLRDLREHKVEMLTLGQYLQPSKFHLPVERYVSPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.337 kDa

MNRPERLQPGVKLRDADKVSRIPVKVVPSERDTMLRKPDWLRVKLPASNQRITDIKQALRKNGLHSVCEEASCPNLSECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPKKLAQTIKDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRLLNPEIKIETLVPDFRGRIDAALEILATEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKKFKERHPNIPTKSGLMMGLGETNEEIAQVLHDLRAHNVEMLTLGQYLQPSKFHLPVERYVSPAEFDELKELAESIGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.345 kDa

MNRPERLQPGVKLRDADKVSRIPVKIVPSERDTMLRKPDWLRVKLPASNQRILDIKQALRSNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPLKPDAEEPVKLAQTIRDMKLKYVVITSVDRDDLRDGGAQHFADCIREIRKLNPAIKIEILVPDFRGRIDAALDILATEPPDVFNHNLETAPMHYRKARPGANYQWSLDLLKRFKERHPNVPTKSGLMMGLGETNEEIAQVLRDLREHKVEMLTLGQYLQPSKFHLPVERYVPPAEFDELKALADELGFTHAACGPLVRSSYHADLQAQGKEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.046 kDa

MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDTNEPLKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPAIKIETLVPDFRGRMDRALEILNATPPDVFNHNLENVPRVYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEAMAMGFTHAACGPFVRSSYHADMQAKGLEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.215 kDa

MRHRWEDRPVAPPPDGRPTEYLPFRQERGRHGRPGWLKARVPDGPGYREIKETMRGLSLHTVCEEARCPNIGECWNNRTATFMILGNVCTRSCGFCAVLTGRPQELDLEEPYRVADAVKKMGLRHAVITSVNRDELPDGGASVFAATIRAIRREVPGCAVEVLTPDFKGDRDAIKTVIDARPDTFNHNIETVPRLYPAVRPQAKYGRSLEVLRYAKELDPGVLTKSGFMVGLGEVEEEIVRTMRDLREHGVDILTIGQYLRPTENHLPMARYYTPQEFARYKKLGLEMGFSHVESGPLVRSSYHAHEQTEDARRGALGARG

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.07 kDa

MSKPIVMERGVKYRDADKMALIPVKNVITERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALEILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK

lipA

Lipoyl synthase

321 amino acids

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.

Belongs to the radical SAM superfamily. Lipoyl synthase family.

36.042 kDa

MSKPIVMERGVKYRDADKMALIPVKNVVTERDALLRKPEWMKIKLPADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVAHGRPVAPDAEEPQKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIRAKSPEIKIETLVPDFRGRMDRALDILNATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFKEAHPEIPTKSGLMVGLGETNAEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSPEEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK