Function
Protein phosphatase which plays an essential role in early embryonic cell division (PubMed:20392746, PubMed:17218259, PubMed:21497766). Probably together with constant regulatory subunit paa-1 and regulatory subunit sur-6, positively regulates centriole duplication by preventing the degradation of sas-5 and kinase zyg-1 (PubMed:21497766). In addition, plays a role in the recruitment of sas-6 and maybe sas-5 to centrioles and may dephosphorylate sas-5 and zyg-1 negative regulator szy-20 (PubMed:21497766). During vulva development, may play a role with regulatory subunits paa-1 and sur-6 in the induction of vulva cell precursors by positively regulating let-60/Ras-MAP kinase signaling, probably by promoting lin-45 activation (PubMed:10521400). In association with regulatory subunit rsa-1 and probably paa-1, regulates microtubule outgrowth from centrosomes and mitotic spindle assembly ensuring the stability of kinetochore microtubules (PubMed:17218259). Plays a negative role in axon guidance probably by dephosphorylating unc-51, unc-14 and vab-8 (PubMed:20392746).
Sequence
MAAAPPSADPLDKALIVDVDQWIEQLYECKPLSENQVKTLCEKAKEILEKEPNVQEVRCPVTVCGDVHGQFHDLMELFKMGGKSPDTNYLFMGDYVDRGYYSVETVSLLVCLKIRYKDRVTLLRGNHESRQITQVYGFYDECLRKYGNSNVWKYFTDLFDCFPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHSNGLTLISRAHQLVMEGYNWSHDRNVVTVFSAPNYCYRCGNQAAMVELDDDLKYSFLQFDPAPRRGEPHVTRRTPDYFL