LAP

Leucine aminopeptidase, chloroplastic

573 amino acids

Presumably involved in the processing and regular turnover of intracellular proteins.

Belongs to the peptidase M17 family.

60.122 kDa

MATLRVSSLLASSPSSLHCNPSVFTKCQSSPRWAFSFSVTPLCSRRSKRIVHCIAGDTLGLTRPNESDAPKISIGAKDTDVVQWQGDLLAIGATENDLARDDNSKFKNPLLQRLDSKLNGLLSAASSEEDFSGKSGQSINLRLPGGRITLVGLGSSASSPTSYHSLGEAAAAAAKSAQARNIAVSLASTDGLSAESKINSASAIATGVMLGIFEDNRFRSESKTPALESLDILGLGTGPEIESKIKYAEHVCAGVILGRELVNAPANIVTPGALAEEAKKIASTYSDVITVNILDAEQCKELKMGAYLGVAAAATENPPYFIHLCFKTNSRERKTKIALVGKGLTFDSGGYNLKTGAGSKIELMKNDMGGAAAVLGAAKALGEIKPRGVEVHFIVAACENMISGAGMRPGDIVTASNGKTIEVNNTDAEGRLTLADALIYACNQGVEKIIDLATLTGAIVTALGPSVAGAFTPSDGLAREVVVAAEASGEKLWRMPMEESYWESMKSGVADMINTGPRDGGAITGALFLKQFVDEKVQWLHLDIAGPVWSDEKKNATGYGVSTLVEWVLRNSL

lap

Aminopeptidase

536 amino acids

A secreted aminopeptidase. Acts on free N-terminal amino groups with a very strong preference for Leu- followed by Met- and Ala-, and no activity on Glu- or Gly- peptides (an exhaustive analysis was not performed). Both the AP56 and AP28 forms have activity.

Belongs to the peptidase M28 family. M28A subfamily.

57.511 kDa

MSNKNNLRYALGALALSVSAASLAAPSEAQQFTEFWTPGKPNPSICKSPLLVSTPLGLPRCLQASNVVKRLQKLEDIASLNDGNRAAATPGYQASVDYVKQTLQKAGYKVSVQPFPFTAYYPKGPGSLSATVPQPVTYEWEKDFTYLSQTEAGDVTAKVVPVDLSLGAGNTSTSGCEAEDFANFPAGSIALIQRGTCNFEQKAENAAAAGAAGVIIFNQGNTDDRKGLENVTVGESYEGGIPVIFATYDNGVAWSQTPDLQLHLVVDVVRKKTETYNVVAETRRGNPNNVVMVGAHLDSVFEGPGINDNGSGSAAQLEMAVLLAKALPVNKVRFAWWGAEEAGLVGSTHYVQNLAPEEKKKIKAYLNFDMIGSPNFGNFIYDGDGSDFGLQGPPGSAAIERLFEAYFRLRGQQSEGTEIDFRSDYAEFFNSGIAFGGLFTGAEGLKTEEQAQKYGGTAGKAYDECYHSKCDGIANINQDALEIHSDAMAFVTSWLSLSTKVVDDEIAAAGQKAQSRSLQMQKSASQIERWGHDFIK

lap

Aminopeptidase

536 amino acids

A secreted aminopeptidase. Acts on free N-terminal amino groups with a very strong preference for Leu in the first position.

Belongs to the peptidase M28 family. M28A subfamily.

57.511 kDa

MSNKNNLRYALGALALSVSAASLAAPSEAQQFTEFWTPGKPNPSICKSPLLVSTPLGLPRCLQASNVVKRLQKLEDIASLNDGNRAAATPGYQASVDYVKQTLQKAGYKVSVQPFPFTAYYPKGPGSLSATVPQPVTYEWEKDFTYLSQTEAGDVTAKVVPVDLSLGAGNTSTSGCEAEDFANFPAGSIALIQRGTCNFEQKAENAAAAGAAGVIIFNQGNTDDRKGLENVTVGESYEGGIPVIFATYDNGVAWSQTPDLQLHLVVDVVRKKTETYNVVAETRRGNPNNVVMVGAHLDSVFEGPGINDNGSGSAAQLEMAVLLAKALPVNKVRFAWWGAEEAGLVGSTHYVQNLAPEEKKKIKAYLNFDMIGSPNFGNFIYDGDGSDFGLQGPPGSAAIERLFEAYFRLRGQQSEGTEIDFRSDYAEFFNSGIAFGGLFTGAEGLKTEEQAQKYGGTAGKAYDECYHSKCDGIANINQDALEIHSDAMAFVTSWLSLSTKVVDDEIAAAGQKAQSRSLQMQKSASQIERWGHDFIK

lap

Cytosol aminopeptidase

520 amino acids

Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides (By similarity).

Belongs to the peptidase M17 family.

56.41 kDa

MLKNIINKKNLFINNQQNIFQIIKRNKMTDSTVDNKGYIVGIYENEEFTPLGQQLNEKTNGHLLKSIKLSDTKGKVGDNLVLYNVTPEVSRVAIVGLGKKENNNSTTYEKNENTRKAIGSGVKALKSKNATHLTIDSNIGDAKQTAEGAFLSNFKFDFKTGTSGKTANSTNESIQVQLSPSPSSEECFKEGKILAESQNFARVLMETPANLLTPTNFVQHVSSQMKELIDSGKVEMIVREEQWVKDQKMGMFWGVAKGSDEPLKFLELHYRGASADGKDSIVYVGKGITFDSGGISIKPSANMGLMKGDMGGAATAVSAMFGVASLGLKVNLITITPLCENMPSGKATKPGDILTAANGKTVEVDNTDAEGRLILGDALHYACSFKPTHIIDIATLTGAIDVALGQHYAGCFTTTDSLWDQLNECGNISGERLWRMPLIPEYRKQMETSKVADLINSAGRSGGACCAAGFLKEFITADQSWSHLDIAGVMSSSEDGPYIRKGMTGKPTRTLIEFAKKNQQ

lap

Phosphatidylinositol-binding clathrin assembly protein LAP

468 amino acids

Assembly protein recruiting clathrin and adaptor protein complex 2 (AP2) to cell membranes at sites of coated-pit formation and clathrin-vesicle assembly. May be required to determine the amount of membrane to be recycled, possibly by regulating the size of the clathrin cage. Involved in AP2-dependent clathrin-mediated endocytosis at the neuromuscular junction.

Belongs to the PICALM/SNAP91 family.

49.867 kDa

MTMAGQTINDRLLAARHSLAGQGLAKSVCKATTEECIGPKKKHLDYLVHCTNEPNVSIPHLANLLIERSQNANWVVVYKSLITTHHLMAYGNERFMQYLASSNSTFNLSSFLDKGTVQDGGMGVPGGRMGYDMSPFIRRYAKYLNEKSLSYRAMAFDFCKVKRGKEEGSLRSMNAEKLLKTLPVLQAQLDALLEFDCQSNDLSNGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMNKKHARDALDLYKKFLVRMDRVGEFLKVAENVGIDKGDIPDLTKAPSSLLDALEQHLATLEGRKVSAANTPTQSSSSAFGTAAASSKFDTTNGIDEQLKAQVLAEEEAAMNQYKSKVSSPTSSGAAGASAALTNPFLSSPPAAQAGQPIVDLFGAASAQPAAAAAATKASDDLLQLGNPFADMFDASGGGAAAVGATGNAGDGTAKYDGGAGSSPFDWGATDDDGGAAQ

LAP

E3 ubiquitin-protein ligase LAP

206 amino acids

E3 ubiquitin-protein ligase which promotes ubiquitination and subsequent degradation of host MHC-I and CD4 molecules, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell. Binds target molecules through transmembrane interaction. The result of this ubiquitination is the enhancement of the endocytosis of the target chain and the delivery to the lysosome, where it is proteolytically destroyed (By similarity).

Belongs to the poxviridae LAP protein family.

23.258 kDa

MATVVNMDTVVNLDDVSLADKCCWICKEACDIVPNYCKCRGDNKIVHKECLEEWINTDVVKNKSCAICESPYNLKRRYKKITKWRCYKRDCHDSLLVNMSLCLIVGGMGGYLLISTEIVKLIASEEVSNIAKVFLVSASMGPFMVSALTMVRACIDCRTYFIATRERNTIHEVAEMEDVEEVEEVNDDDGDEYVDAVEEIVVESPA

LAP

E3 ubiquitin-protein ligase LAP

156 amino acids

E3 ubiquitin-protein ligase which promotes ubiquitination and subsequent degradation of host MHC-I and CD4 molecules, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell. Binds target molecules through transmembrane interaction. The result of this ubiquitination is the enhancement of the endocytosis of the target chain and the delivery to the lysosome, where it is proteolytically destroyed.

Belongs to the poxviridae LAP protein family.

18.29 kDa

MSNICWICNDTCDERNNFCICSEEYKIVHLKCMQSWINYSKKVECDLCKNKYNIKKSYHYFSRWKWCFSDKKTVLSKILFIFFAVGFIFITTSMSSNVASLVTRIDDTFFDVVFLTVYISMILVTVCLCVFVLALAVDFLLDAKEKNSFLTIKEIV

LAP

E3 ubiquitin-protein ligase LAP

155 amino acids

E3 ubiquitin-protein ligase which promotes ubiquitination and subsequent degradation of host MHC-I and CD4 molecules, presumably to prevent lysis of infected cells by cytotoxic T-lymphocytes and NK cell. Binds target molecules through transmembrane interaction. The result of this ubiquitination is the enhancement of the endocytosis of the target chain and the delivery to the lysosome, where it is proteolytically destroyed.

Belongs to the poxviridae LAP protein family.

18.461 kDa

MDPVCWICKDDYSIEKNYCNCKNEYKVVHDECMKKWIQYSRERSCKLCNKEYNIISVRKPFSQWVFSIKDCKKSAILYATLFLCTFIISLVLTRINITKIIDTSKNDVSFKLVTMIFYLLPFVITCISFITLIVYLYKYCKISAKNNTYDTIYEL

LAP

Lingual antimicrobial peptide

64 amino acids

Shows a broad spectrum of antibacterial and antifungal activities.

Belongs to the beta-defensin family. LAP/TAP subfamily.

7.041 kDa

MRLHHLLLALLFLVLSAGSGFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK