About Services Proteins Contact

lafU

Gene
lafU
Protein
Chemotaxis protein LafU
Organism
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Length
330 amino acids
Function
Probable integral membrane protein required for the rotation of the flagellar motor. Might be a linker that fastens the torque-generating machinery to the cell wall.
Similarity
Belongs to the MotB family.
Mass
36.611 kDa
Sequence
MQKQEHVVFKRAKAHGHDEPHGGAWKVAFADFMIALMALFLVLWVMQVVDKEERKAIVAHLHSSSVFDKSYGNPFDTSQSISPIDLAQDSSVPSKHNSNHVVSSYFQGDGDGPEINSLVPGTFDTQEQLAALAKVIEEMTAQINAQGNVNVTVTPQGLRIVLQDDYKQHMFSRGGAELTPFFEDLLLALAPLFEQVTNPLIISGHTDAIPFKKRFGRQSNWALSASRADVARKTLVEGGMPDDRVMQVTGMSDRALLNPDEPDSSENRRIELFILTTPAAKVLETLFGNQDDSELQKAKQKAEFNQPVIRQEVIRYSADAEKQEAKIQAL

Gene
lafU
Protein
Putative flagellar export/assembly protein LafU
Organism
Escherichia coli O44:H18 (strain 042 / EAEC)
Length
307 amino acids
Function
Part of the flagellar gene cluster Flag-2. However, the Flag-2 flagellar system could be inactive in strain 042 due to a frameshift in lfgC.
Similarity
Belongs to the MotB family.
Mass
34.227 kDa
Sequence
MRKTGNRRERGAKTTIVRRQIKKNHAGHHGGAWKVAFADFTLAMMALFMTLWIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPATVAAPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNPQSAGNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVHSQRTR

Gene
lafU
Protein
Putative truncated flagellar export/assembly protein LafU
Organism
Escherichia coli (strain K12)
Length
211 amino acids
Similarity
Belongs to the MotB family.
Mass
23.779 kDa
Sequence
MAVPEETEKKARDVNEKTALLKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGSAKIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDSKNPQSAGNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR