laf2

SWIRM domain-containing protein laf2

272 amino acids

Component of the RPD3C(L) histone deacetylase complex (HDAC) responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.

31.109 kDa

MQILKDQENLNPDGGSFVLITPPLSPPKQKSLSYTNISRRHGMRACMKGIVYEVYKNQPKLWLQQELIWLRRKRIHPIPKARRNNHVGRWANRHSNVSSSSGSRGRSSVSSRDSSPSYSGALRSAERSISSSPSTIEARRRKSARGNGLNGAIDVANLPFEELPNFCPDMSVLDNRTHPRTLKAEWKGPPLDLSDDPYRDLLHPAELHLASTLRLPCLIYLDNKKRIFAEWHHRRQQGLTFRKTDAQRASRVDVNKASRLWKAFHEVGFFDD