About Services Proteins Contact

lacC2

Gene
lacC2
Protein
Tagatose-6-phosphate kinase 2
Organism
Streptococcus agalactiae serotype III (strain NEM316)
Length
310 amino acids
Similarity
Belongs to the carbohydrate kinase PfkB family. LacC subfamily.
Mass
33.742 kDa
Sequence
MILTVTLNPSIDISYCLENFNMDTVNRVTDVSKTPGGKGLNVTRVLSQLGDNVVATGLLGGDFGDFIRSGLDALEIRHQFLSIGGETRHCIAVLHEGQQTEILEKGPHITKDEADAFLNHLKLIFDAATIITVSGSLPKGLPSDYYARLISLANHFNKKVVLDCSGEALRSVLKSSAKPTVIKPNLEELTQLIGKPISYSLDELKSTLQQDLFRGIDWVIVSLGARGAFAKHGNHYYQVTIPKIEVINPVGSGDATVAGIASALEHQLDDTNLLKRANVLGMLNAQETLTGHINLTYYQELISQIQVKEV