Function
Ketoisovalerate reductase; part of the gene cluster that mediates the biosynthesis of beauvericin (BEA), a non-ribosomal cyclic hexadepsipeptide that shows antibiotic, antifungal, insecticidal, and cancer cell antiproliferative and antihaptotactic activity (PubMed:18804027). Ketoisovalerate reductase BEA2 catalyzes the NADPH-specific reduction of ketoisovaleric acid to hydroxyisovalerate, a precursor for beauvericin biosynthesis (By similarity). The nonribosomal cyclodepsipeptide synthetase BEA1 then catalyzes the formation of beauvericin via condensation and cyclisation of 3 dipeptidol monomers, each composed of one unit of hydroxyisovalerate and one unit of N-methyl-phenylalanine (PubMed:18804027).
Sequence
MPSPEHPSWLSTLLADTRPPPKLFAWSPANLDSPTAVKPDRADRGDFDPGKYPVDAPITTASEPVKRIYIVGPGNVGRLYASYMSRQRDALPITLVVHRKELLSQWVTSEGVVLADRGGKVTKNKQFDVEWWTESRPRYGPVREVADGEKLHNVFISTKADAGLGEADRLRRYLGRCSSVVFAQNGVSKLWAPYGPLYVASRYHADDAPSFSACVVNHGISAAGLFYSIHTSPSDAFIGPIFKGSAAPAHGQNKRRRLDDDFFTTYISSTPFLDTKHVSSGQLWIIQLEKLVLNAAINPLTTLLRCKTGQLFASYDSHDALTRVLDQLLWQASAVIQALINHDANIDMLTSYAETVHRLVPGSDDYGRNFANIRRKLTVRFSQPILKAKLYAFGLNIREHRSSMLQDAEAGRKTEIRDVNGWIVDMAEYLGLDLDVGIHRGLIELIEECVVLDKEELARRLL