iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.36 kDa

MNQQLNNLTLPIYMDYQATTPLDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAERAVEEARSRVARLIGADTKEIIFTSGATESNNLAIKGVAKFYGNKKNHIITVVSEHKCVLDACRYLEQEGINITYLPVKPNGIIALETLKNAITDQTMLVSVMAVNNEIGVVQPLKEIGKICRARGVFFHSDIAQGFGKIPIDVNEFNIDLASISGHKIYGPKGIGGLYVRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGVAAEIAYSEMEKDTKHVNYLFDRFLNNIHSRISEVYLNGAKDPRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTSIRFGIGRFTTEQEIDYAVNLICSKIDKLRKLSPLWEMMQEGIDLKKIKWAVH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.234 kDa

MNTQLNNLILPIYMDYQATTPLDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARGDIAKLIGAEAKEIIFTSGATESNNLAIKGIAKFYGNKKNHIITVVSEHKCVLDACRHLEQEGVKVTYLPIKPNGIIDLEVLKNAITDQTMLVSVMAVNNEIGVIQPLKEIGKICREKGVFFHSDIAQGFGKVPIDVNECNIDLASISGHKIYGPKGIGALYVRKKPRVRITPLINGGGQERGMRSGTLPTPLIVGLGTAANIAYNEMEKDTKHVNHLFDKFLDAINSQISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSMGVDEELAHTSIRFGIGRFTTEQEIDYAVKLICSKINKLRDLSPLWEMMQEGIDLKKIKWATH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.189 kDa

MNTQLNNLILPIYMDYQATTPLDPRVMEAMLPYFTTKFGNPHSHSHSFGWEAENAVEEARGDIAKLIGAEAKEIIFTSGATESNNLAIKGIAKFYGNKKNHIITVVSEHKCVLDACRHLEQEGVKVTYLPIKPNGIIDLEVLKNAITDQTMLVSVMAVNNEIGVIQPLKEIGKICREKGVFFHSDSAQGFGKVPIDVNECNIDLASISGHKIYGPKGIGALYVRKKPRVRITPLINGGGQERGMRSGTLPTPLIVGLGTAANIAYNEMEKDTKHVNHLFDKFLDAINSQISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSMGVDEELAHTSIRFGIGRFTTEQEIDYAVKLICSKINKLRDLSPLWEMMQEGIDLKKIKWATH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.489 kDa

MNPQLHNIILPIYMDYQATTPLDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSRVAKLIGADAKEIIFTSGATESNNLAIKGIAKFYGNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPINPNGIIDLEILKESITNQTMLVSVMAVNNEIGVIQPLKEIGKICRERGVFLHSDIAQGFGKIPINVNEFNIDLASISGHKIYGPKGVGALYVRKKPRIRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYNEMEKDNKHVSYLFDRFLNNIKQKISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTSIRFGIGKFTTEQEIDYAVDLICSKIDKLRELSPLWEMMQQGIDLKKIKWASH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.475 kDa

MNPQLNNLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIGVVQPLKEIGKICREKGVFFHSDIAQGFGKIPIDVNAFNIDLASISGHKIYGPKGIGALYVRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHVNYLFDRFLNNIHKRISEVYLNGDKNQRYKGNLNLSFAGVEGESMILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTAIRFGIGRFTTEQEVDYAVNLICSKIDKLRELSPLWEMMQEGIDLKKIKWAVH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.477 kDa

MNPQLNNPNLPIYMDYQATTPLDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSRVARLIGADTKEIIFTSGATESNNLAIKGIAKFYGNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMAVNNEIGVVQPLKEIGKICRERGVFFHSDIAQGFGKIPIDVNEFNIDLASISGHKIYGPKGIGALYVRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYSVMEKDTKHVNYLFDRFLNNIHNRISEVYLNGDKNQRYKGNINLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTSIRFGIGRFTTEQEVDYAVDLICSKIDKLRELSPLWEMVQEGIDLKKIKWATH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.515 kDa

MNPQLNKLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIGVVQPLKEIGKICREKGVFFHSDIAQGFGKIPIDVNEFNIDLASISGHKIYGPKGIGALYVRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHVNYLFDRFLNNIHKRISEVYLNGDKNQRYKGNVNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTAIRFGIGRFTTEQEVDYAVNLICSKIDKLRELSPLWEMMQEGIDLKKIKWAVH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.598 kDa

MNQQLKNLTLPIYMDYQSTTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVENARSMVAKVIGADSKEIIFTSGATESNNLVIKGIAKFYGNKKKHIITLVSEHKCVLNACRHLEQEGIKITYLPIKSNGIIDLETLKNAITDQTLLVSVMAVNNEIGVIQPLKEIGKICRERNVFFHSDIAQGFGKIPINVNECNIDLASISGHKIYGPKGIGALYIRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGIASEIAYNEMEKDTQHVNYLFDRFLNNIHSKISEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLVCSKIDKLRRLSPLWEMMQEGVDLKKIRWTAH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.417 kDa

MNPQLNNLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIGVVQPLKEIGKICREKGVFFHSDIAQGFGKIPIDVNAFNIDLASISGHKIYGPKGIGALYVRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHVNYLFDRFLNNIHKRISEVYLNGDKNQRYKGNLNLSFAGVEGESMILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTAIRFGIGRFTTEQEVDYAVNLICSKIDKLRALSPLWEMMQEGIDLKKIKWAVH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.4 kDa

MTPQLNNLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIGVVQPLKEIGKICREKGVFFHSDIAQGFGKIPIDVNAFNIDLASISGHKIYGPKGIGALYVRKKPRVRITPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHVNYLFDRFLNNIHKRISEVYLNGDKNQRYKGNLNLSFAGVEGESMILAIKDLAVSSGSACTSASLEPSYVLRSIGIGEELAHTAIRFGIGRFTTEQEVDYAVNLICSKIDKLRALSPLWEMMQEGIDLKKIKWAVH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.4 kDa

MTPQLNNLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIGVVQPLKEIGKICREKGVFFHSDIAQGFGKIPIDVNAFNIDLASISGHKIYGPKGIGALYVRKKPRVRITPLINGGGQERGMRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHVNYLFDRFLNNIHKRISEVYLNGDKNQRYKGNLNLSFAGVEGESMILAIKDLAVSSGSACTSASLEPSYVLRSIGIGEELAHTAIRFGIGRFTTEQEVDYAVNLICSKIDKLRALSPLWEMMQEGIDLKKIKWAVH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.761 kDa

MNQQLKNLTLPIYMDYQSTTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVENARSMIAKLIGADSKEIIFTSGATESNNLVIKGIAKFYGNKKNHIITLVSEHKCVLNACRYLEQEGIKITYLPIKPNGIIDLEILKNAITDQTLLVSVMAVNNEIGVIQPLREIGKICRERSVFFHSDIAQGFGKIPINVNEYNIDLASISGHKIYGPKGIGALYIRKKPRVRVTPLINGGGQERGMRSGTLPTPLIVGFGIAAEISYNEMEKDAQHVNYLFDRFLNNIYSRIPEVYLNGDKDQRYKGNLNLSFAGVEGESIILAIKDLAVSSGSACTSASLEPSYVLRSIGISEELAHTSIRFGIGRFTTEQEIDYAVNLICSKIDKLRKLSPLWEMMQEGIDLKKIKWTAH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

46.097 kDa

MEQEKRQINLPVFLDYQSTTKTDDRVLEAMMPYFKQFSNPHSRSHSFGWKAESAVELARERVASLINAEAKEVIFTSGATESNNLAIKGVANFYKNKGNHIITVRTEHKCVLDSCRYLETEGFHVTYLDVQKNGILDLELLKSSITDKTILVSVMMVNNEIGVIQPIEKIGKICHEHGIFFHTDAAQAFGKISIDVKKMNIDLLSISGHKIYAPMGIGALYIRKRQPRVRLTPMINGGGQERGMRSGTVPTPLAVGLGEAARIAQEVMEEENIRIRELRDILYNEIKKHLPYVVLNGDYEQRIAGNLNLSFPYVEGESIIMAINNLAVSSGSACTSASLEPSYVLRALNIEKDLEHSSIRFGIGRFTTREEILYAAELIVSSIKKLREMSPLWEMVQEGVDLNNIKWDAH

iscS

Cysteine desulfurase IscS

410 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.47 kDa

MNPQLNNLTLPIYMDYQATTPIDPRVMEAMLPYFTTKFGNPHSRSHSFGWEAENAVEEARSMVAKLIGADTKEIIFTSGATESNNLAIKGIAKFYSNKKNHIITVVSEHKCVLDACRHLEQEGIKITYLPIKPNGIIDLETLKNAITDQTMLVSVMVVNNEIGVVQPLKEIGQICREKGVFFHSDIAQGFGKIPIDVNAFNIDLASISGHKIYGPKGIGALYVRKKPRVRVTPLINGGGQERGIRSGTLPTPLIVGLGMAAEIAYSEMEKDTKHINYLFDRFLNNIHKRISKVYLNGDKNQRYKGNLNLSFAGVEGESMILAIKDLAVSSGSACTSASLEPSYVLRSMGIGEELAHTAIRFGIGRFTTEQEVDYAVNLICSKIDKLRELSPLWEMMQEGIDLKKIKWAVH

iscS

Cysteine desulfurase IscS

406 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.607 kDa

MKLPIYLDYAATTPMDERVVQKMMQYMTKDGIFGNPASRSHKFGWEAEEAVDIARNHIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITLKTEHKAVLDTCRQLEREGFEVTYLEPESDGLLDLTKLVEAIRPDTILISIMHVNNEIGVVQDIKAIGEICRARKIIFHVDATQSVGKLAVNVQELKVDLMSFSSHKLYGPKGIGGLYVCRKPRIRIEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLKALRDRLYHGFQAIEEVYVNGSMEEGKRVDTNLNMSFNFVEGESLMMALRDIAVSSGSACTSASLEPSYVLRAIGRNDELAHSSIRFSLGRWATEEEIDYTIELVKKSILKLRELSPLWEMFKEGIDLSKIEWNHH

iscS

Cysteine desulfurase IscS

406 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.2 kDa

MKLPIYLDYAATTPVDERVAKKMMEYMTKDGVFGNPASRSHKFGWEAEEAVDVARNQIADLIGADAREIVFTSGATESDNLAIKGAAHFYQTKGKHIITVKTEHKAVLDTCRQLEREGFEVTYLEPETTGLVDIAKLEAAIRPDTILVSVMQVNNEIGVIQPIEEIGKICRAKKIIFHVDATQSVGKIPVDVQALNVDLMSFSSHKLYGPKGIGGLYVCRKPRVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMVTEMPRIKALRDRLYNGFKDMEEVYVNGTMEAGKRVDSNLNISFNFVEGESMMMSLKDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSIGRWTTEEEIDHTIEIVKKAVTKLRELSPLWDMFKEGIDLNSIEWSHH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.006 kDa

MTVRTPIYLDYSATTPIDPRVAEKMIPYLTEHFGNPASRSHAFGWTAEKAVENAREEVARLVNADPREIVWTSGATESNNLAIKGAANFYSPSKGKHIVTVQTEHKAVIDTVRELERLGYEATYLIPEPNGLIDLDKFKAALRPDTVLASVMLVNNEIGVIQDIEAIGNICREQGVIFHVDAAQATGKVHIDLQKLPVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLATHQIVGMGEAFRIAREEMDSENVRIRQLRDRLLKGLQEIEEVYVNGDLEHRVAHNLNISFNFVEGESLIMAVKDIAVSSGSACTSASLEPSYVLRALGRSDELAHSSIRFSIGRFTTEEEIDYTIQLMKSKIGKLRELSPLWEMHLEGVDLNAVAWATH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.781 kDa

MTMKLPIYLDYSATTPVDPRVAEKMIPYLCEHFGNPASRSHSFGWVADAAVEEAREQVAALVNADPKEIVWTSGATESNNLAIKGAANFYASTKGKHIITVKTEHKAILDTVREMERQGFEATYLDVKEDGLLDLEVFKAAIRPDTVLASVMFVNNEVGVIQPIAELGEICREKGIIFHVDAAQATGKVDIDLSKLKVDLMSFCAHKTYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGECFRLAKEEMAEENKRVGALRDKLLKGLQDIEATFVNGDLTQRVAHNLNISFAYVEGESMIMAIKDLAVSSGSACTSASLEPSYVLRALGRDDELAHSSIRFSIGRFTTEEEIDYAIKLLHQKVGKLRELSPLWEMYKDGIDLSTVQWAAH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.214 kDa

MKLPIYLDYAATTPVDERVAKEMMQCLTMDGNFGNPASRSHRFGWQAEEVVDQARTDVADLINADPREIVFTSGATESNNLAIKGAAQFYKKKGKHIITAKTEHKAVIDTCRELERQGFEVTYMDVEENGLLDLQKLADTMRDDTVLVSIMHVNNELGVIQDIATIGEMCRERKIMFHVDAAQSAGKVLIDVQQLKVDFMSFSGHKVYGPKGVGALYVRRKPRARLEAQMHGGGHERGMRSGTLATHQLVGMGTAFRVAKQDFEKDHAHISALRKRLIDGIMSDMEEVYFNGTQDQSVPGIVNISFNFVEGESLLMAVKDIAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFSIGRFTTEEEIDYTVELMKNSIGRLREMSPLWEMHQEGIDLDSVEWAHH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.853 kDa

MKRPIYLDYAATTPVDPQVAERMMECLTFDGTFGNAASRSHAYGWQAEEKVEYAREQVANLIKADPREIVWTSGATESDNLALKGVAQFYASKGKHIITSKIEHKAVLDPCRELEEQGFEITYLEPEPQTGLITPEMVKAALRPDTILVSLMMVNNEIGTVTDVAAIGELTRANKTFFHVDAAQAAGKVDIDLSTMKIDLMSFSAHKIYGPKGIGALYVRRSPRVRLKAQIHGGGHERGMRSGTLATHQIVGMGEAFELAGKTMHAEQERIRKLRDKLWNGLQDLEQVFLNGHPTQNVANYLNVSFNFVEGESLMMSLKDAAVSSGSACTSATLEPSYVLRALGLSDELAHSSIRFSFGKYTTEEDIDHVLTITKAAVEKLRELSPLWDMYKEGIDLSTVEWAEH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.853 kDa

MKRPIYLDYAATTPVDPQVAERMMECLTFDGTFGNAASRSHAYGWQAEEKVEYAREQVANLIKADPREIVWTSGATESDNLALKGVAQFYASKGKHIITSKIEHKAVLDPCRELEEQGFEITYLEPEPQTGLITPEMVKAALRPDTILVSLMMVNNEIGTVTDVAAIGELTRANKTFFHVDAAQAAGKVDIDLSTMKIDLMSFSAHKIYGPKGIGALYVRRSPRVRLKAQIHGGGHERGMRSGTLATHQIVGMGEAFELAGKTMHAEQERIRKLRDKLWNGLQDLEQVFLNGHPTQNVANYLNVSFNFVEGESLMMSLKDAAVSSGSACTSATLEPSYVLRALGLSDELAHSSIRFSFGKYTTEEDIDHVLTITKAAVEKLRELSPLWDMYKEGIDLSTVEWAEH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.853 kDa

MKRPIYLDYAATTPVDPQVAERMMECLTFDGTFGNAASRSHAYGWQAEEKVEYAREQVANLIKADPREIVWTSGATESDNLALKGVAQFYASKGKHIITSKIEHKAVLDPCRELEEQGFEITYLEPEPQTGLITPEMVKAALRPDTILVSLMMVNNEIGTVTDVAAIGELTRANKTFFHVDAAQAAGKVDIDLSTMKIDLMSFSAHKIYGPKGIGALYVRRSPRVRLKAQIHGGGHERGMRSGTLATHQIVGMGEAFELAGKTMHAEQERIRKLRDKLWNGLQDLEQVFLNGHPTQNVANYLNVSFNFVEGESLMMSLKDAAVSSGSACTSATLEPSYVLRALGLSDELAHSSIRFSFGKYTTEEDIDHVLTITKAAVEKLRELSPLWDMYKEGIDLSTVEWAEH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.881 kDa

MKRPIYLDYAATTPVDPQVAERMMECLTFDGTFGNAASRSHAYGWQAEEKVEYAREQVANLIKADPREIVWTSGATESDNLALKGVAQFYASKGKHIITSKIEHKAVLDPCRELEEQGFEITYLEPEPQTGLITPEMVKAALRPDTILVSLMMVNNEIGTVTDVAVIGELTRANKTFFHVDAAQAAGKVDIDLSTMKIDLMSFSAHKIYGPKGIGALYVRRSPRVRLKAQIHGGGHERGMRSGTLATHQIVGMGEAFELAGKTMHAEQERIRKLRDKLWNGLQDLEQVFLNGHPTQNVANYLNVSFNFVEGESLMMSLKDAAVSSGSACTSATLEPSYVLRALGLSDELAHSSIRFSFGKYTTEEDIDHVLTITKAAVEKLRELSPLWDMYKEGIDLSTVEWAEH

iscS

Cysteine desulfurase IscS

405 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.853 kDa

MKRPIYLDYAATTPVDPQVAERMMECLTFDGTFGNAASRSHAYGWQAEEKVEYAREQVANLIKADPREIVWTSGATESDNLALKGVAQFYASKGKHIITSKIEHKAVLDPCRELEEQGFEITYLEPEPQTGLITPEMVKAALRPDTILVSLMMVNNEIGTVTDVAAIGELTRANKTFFHVDAAQAAGKVDIDLSTMKIDLMSFSAHKIYGPKGIGALYVRRSPRVRLKAQIHGGGHERGMRSGTLATHQIVGMGEAFELAGKTMHAEQERIRKLRDKLWNGLQDLEQVFLNGHPTQNVANYLNVSFNFVEGESLMMSLKDAAVSSGSACTSATLEPSYVLRALGLSDELAHSSIRFSFGKYTTEEDIDHVLTITKAAVEKLRELSPLWDMYKEGIDLSTVEWAEH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.906 kDa

MSTPTYMDYSATTPVDERVAQKMMQYLTTDGNFGNPASNSHYYGWKADEAVKKARHQVADLVGADSKEIVWTSGATESDNLAIKGIAHFYHKKGNHIITLKTEHKAVLDTCRQLERENYEATYLDPMPNGLLDLNVLKKAIREDTILVSIMHVNNEIGVIQDIEAIGNLCRENKIFFHVDAAQSAGKVTIDLSKLPVDLMSFSAHKIYGPKGMGALYVRRKPRVRIEAQMHGGGHERGMRSGTLATHQIVGMGEAFAIAQAEMKEENSKIRQLRDRLLAGFVNMEEVVINGDMKNRIPGNLNISFNYVEGESLMMAVNDIAVSSGSACTSSSLEPSYVLRALGLSDELAHSSIRFTIGRYTTEAQVDKAINLVRTKVDKLRDLSPLWDMFKDGIDISKVEWTAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.979 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQSNGIIDLKALEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Preferentially binds to disordered IscU on which the Fe-S is assembled, IscU converts to the structured state and then dissociates from IscS to transfer the Fe-S to an acceptor protein. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate. Transfers sulfur onto 'Cys-456' of ThiI and onto 'Cys-19' of TusA in transpersulfidation reactions.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.896 kDa

MKLPIYMDYSATTPADPRVAEKMMQYLTLDGTFGNPASRSHRFGWQAEEAVDVARNNIAELVGSDPREIVFTSGATEADNLAIKGAANFYQKKGKHIITCKTEHKAVLDTCRQLEREGFEVTYMTPQPNGLIDLNALEAVMRDDTILVSIMHVNNEIGIIQDIETIGEMCHARGIIFHVDATQSVGKLPIDLSKLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMSTEVLRLRVLRDRLWNGLKDIEEVYLNGALEQGAPNILNVSFNFVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEVDYAIDLVRKSIGRLRELSPLWEMHKQGVDISTIEWSAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.079 kDa

MKLPIYLDYSATTPVDPRVAEKMMQCLTLDGNFGNPASRSHRFGWHAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFDVTYLAPKSNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFTGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRTLRNRLWDGVKDMEEVYLNGDLEQGVPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMTDELAHSSIRFSLGRFTTEEEIDYTIKLVRNSIGRLRDLSPLWEMFKQGVDINSIEWSHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.071 kDa

MKLPIYLDYSATTPVDPRVAEKIMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.855 kDa

MKLPIYLDYAATCPVDERVAKKMMAFLTIDGTFGNPASRSHKFGWQAEEAVDIARNQIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHILTCKTEHKAVLDTCRQLEREGFEVTYLSPEADGLIDLEKFKAALRPDTILASIMHANNEIGVLQDIKAIGELCRANKTIFHVDATQSVGKVEINLEELAVDLMSMSSHKLYGPKGVGALYVRRKPRVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMASEMPRLKALRDRLYNGLKDIEETYVNGSMEHRLDSNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTLGRYTTEEEIDYTINLMKGAVEKLRALSPLWDMFKEGIDLNTIEWSAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.855 kDa

MKLPIYLDYAATCPVDERVAKKMMAFLTIDGTFGNPASRSHKFGWQAEEAVDIARNQIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITCKTEHKAVLDTCRQLEREGFEVTYLSPEADGLIDLEKFKAALRPDTILASIMHANNEIGVLQDIKAIGELCRANKTIFHVDATQSVGKVEINLEELAVDLMSMSSHKLYGPKGVGALYVRRKPRVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMASEMPRLKALRDRLYNGLKDIEETYVNGSMEHRLDSNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTLGRYTTEEEIDYTINLMKGAVEKLRALSPLWDMFKEGIDLNTIEWSAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.855 kDa

MKLPIYLDYAATCPVDERVAKKMMAFLTIDGTFGNPASRSHKFGWQAEEAVDIARNQIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITCKTEHKAVLDTCRQLEREGFEVTYLSPEADGLIDLEKFKAALRPDTILASIMHANNEIGVLQDIKAIGELCRANKTIFHVDATQSVGKVEINLEELAVDLMSMSSHKLYGPKGVGALYVRRKPRVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMASEMPRLKALRDRLYNGLKDIEETYVNGSMEHRLDSNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTLGRYTTEEEIDYTINLMKGAVEKLRALSPLWDMFKEGIDLNTIEWSAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.049 kDa

MKLPIYLDYAATCPVDERVVKKMMEFLSIDGNFGNPASRSHKFGWQAEEAVDVARNHIADLIGADSREIVFTSGATEADNLALKGVMRFYQTKGKHLITCKTEHKAILDTCRQLEREGFEVTYLDPKSDGLIDLEELKSVIRDDTVLVSIMHANNEIGVVQDIAKIGEICRERKVLFHTDATQSVGKLPINLSELKVDLLSMSSHKLYGPKGIGALYVCRKPRVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLTALRDRLYNGLKDIEETYVNGSMEQRLGNNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTVGRYTTAEEIDYAIGLVKSAVEKLRDLSPLWDMFKEGIDLNSIEWTHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.001 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIAELLNADPREIVFTSGATESDNLAIKGAAHFYSKQGKHVITSKTEHKAVLDTCRQLEREGFEVTYLEPESNGLISLSKLEAAMRDDTVLVSIMHVNNEIGVIQDIEAIGELCRSRKIIFHVDAAQSAGKVAIDVQKLKVDLISLSAHKIYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKLDMEKDYQHALALRNRLLDGVKDMEAVTINGDLDQRVPHNLNISFAFVEGESLLMSLKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSFGRFTTEEEIDYAIEQIRVAVEKLRDMSPLWDMYKDGIDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.957 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIAELLNADPREIVFTSGATESDNLAIKGAAHFYSKQGKHVITSKTEHKAVLDTCRQLEREGFEVTYLEPESNGLISLSKLEAAMRDDTVLVSIMHVNNEIGVIQDIEAIGELCRSRKIIFHVDAAQSAGKVAIDVQKLKVDLISLSAHKIYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKLDMEKDYQHALALRNRLLDGVKDMEAVTINGDLDQRVPHNLNISFAFVEGESLLMSLKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSFGRFTTEEEIDYAIEQIRVAVAKLRDMSPLWDMYKEGIDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.001 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIAELLNADPREIVFTSGATESDNLAIKGAAHFYSKQGKHVITSKTEHKAVLDTCRQLEREGFEVTYLEPESNGLISLSKLEAAMRDDTVLVSIMHVNNEIGVIQDIEAIGELCRSRKIIFHVDAAQSAGKVAIDVQKLKVDLISLSAHKIYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKLDMEKDYQHALALRNRLLDGVKDMEAVTINGDLDQRVPHNLNISFAFVEGESLLMSLKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSFGRFTTEEEIDYAIEQIRVAVEKLRDMSPLWDMYKDGIDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.957 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIAELLNADPREIVFTSGATESDNLAIKGAAHFYSKQGKHVITSKTEHKAVLDTCRQLEREGFEVTYLEPESNGLISLSKLEAAMRDDTVLVSIMHVNNEIGVIQDIEAIGELCRSRKIIFHVDAAQSAGKVAIDVQKLKVDLISLSAHKIYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKLDMEKDYQHALALRNRLLDGVKDMEAVTINGDLDQRVPHNLNISFAFVEGESLLMSLKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSFGRFTTEEEIDYAIEQIRVAVAKLRDMSPLWDMYKEGIDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.136 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQISELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIVKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.062 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYAIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.106 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSATLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.092 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.88 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQSNGIISLQALEAAMREDTILVSIMHVNNEIGVVQDIEAIGEMCRARGIIYHVDATQSVGKLPIDLSKLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQIHGGGHERGMRSGTLPVHQIAGMGEAYRIAKEEMASEMARLRTLRDRLWNGVKDMEEVYLNGSLENGVPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMTDELAHSSIRFSLGRFTTEEEIDYTIQLVRKSIGRLRDLSPLWDMFKQGVDINSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.8 kDa

MKLPIYFDYAATTPVDPRVAQKMMQYMTMDGIFGNPASRSHRYGWQAEEAVDVARSQVADLINADHREIVFTSGATESNNLAIKGVAHFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPGVNGIIPMERLEAAMRDDTILLSLMHVNNEIGVVHDIDAIGELCRSKGIIFHVDAAQSAGKLPIDVQITKVDLMSISGHKMYGPKGIGALYVRRKPRIRLESQMHGGGHERGMRSGTLATHQIVGLGEAAAIAKADMESDNARIHALRDRLWNGIKDIEETYVNGDFEQRYCGNLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLSDEMAHSSIRFSIGRFTTEEEVDYAIGIIQGSIGKLREMSPLWEMFKDGVDLSKVEWVHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.645 kDa

MKLPIYLDYAATTPVDPRVAEKMFQCMTMDGIFGNPASRSHRYGWQAEEAVDIARNQIAELINADHREIVFTSGATESNNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPAANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDIDAIGELCRSKGIIFHMDAAQSAGKVPIDVQATQVDLLSISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEAAAIAKAEMASDDARIGALRDKLWNGIKHIEETYINGDAIERVSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIEVITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.675 kDa

MKLPIYLDYAATTPVDPRVAEKMFQCMTMDGIFGNPASRSHRYGWQAEEAVDIARNQIAELINADHREIVFTSGATESNNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPAANGIIPMERLETAMRDDTILVSIMHVNNEIGVIHDIDAIGELCRSKGIIFHMDAAQSAGKVPIDVQATKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEAAAIAKAEMASDDARIGALRDKLWNGIKHIEETYINGDAIERVSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIEVITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.645 kDa

MKLPIYLDYAATTPVDPRVAEKMFQCMTMDGIFGNPASRSHRYGWQAEEAVDIARNQIAELINADHREIVFTSGATESNNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPAANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDIDAIGELCRSKGIIFHMDAAQSAGKVPIDVQATKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEAAAIAKAEMASDDARIGALRDKLWNGIKHIEETYINGDAIERVSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIEVITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.645 kDa

MKLPIYLDYAATTPVDPRVAEKMFQCMTMDGIFGNPASRSHRYGWQAEEAVDIARNQIAELINADHREIVFTSGATESNNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPAANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDIDAIGELCRSKGIIFHMDAAQSAGKVPIDVQATKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEAAAIAKAEMASDDARIGALRDKLWNGIKHIEETYINGDAIERVSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIEVITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.01 kDa

MKLPIYLDYAATTPVDPRVAEKMMQHMTMDGVFGNPASRSHKYGWQAEEAVDIARNQVADLINADHREIVFTSGATESINLAIKGIAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGYEVTYLEPEANGLIPLARIEDAMRDDTLLVSIMHVNNEIGVIQDVMAIGELCRSKGIIFHMDAAQSAGKLPIDVQQLKVDLISISGHKMYGPKGVGALYVRRKPRIRLESQMHGGGHERGMRSGTLATHQLVGLGEAAAIAKQDMESDNARIRTLRDKLWNGVKHIEETYINGDMEQRFCGSLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTDEDIDHAIKVITQSIDKLREMSPLWEMFKDGIDLDQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.974 kDa

MKLPIYLDYAATTPVDPRVAEKMMQHMTMDGVFGNPASRSHRYGWQAEEAVDVARNQVADLINADHREIVFTSGATESSNLAIKGIAHFYHKKGKHIITSKTEHKATLDTCRQLEREGYEVTYLVPDANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDINAIGELCRSKGIFFHMDAAQSAGKIPIDVQTTKVDLISISGHKMYGPKGIGALYVRRKPRIRLESQMHGGGHERGMRSGTLATHQIVGLGEAAAVAKQDMAADSARITHLRDKLWNGIKHIEETYINGDMEQRYSGIFNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTDEEIDHAIKTITESIDKLREMSPLWEMFKDGIDLEQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.593 kDa

MKLPIYLDYAATTPVDPRVAEKMMQCLTMDGIFGNPASRSHRYGWQAEEAVDIARNQVADLINADPREIVFTSGATESDNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGYEVTYLQPEPSGLIPVAMIEAAMREDTILVSIMQVNNEIGVIQDIDAIGELCRSRKIIFHVDAAQSAGKLPIDVQTTKVDLMSISGHKMYGPKGIGALYVSRKPRIRLEAAMHGGGHERGMRSGTLATHQIVGMGEAAAIAKADMVVDNERIARLRDKLWNGIKHIEETYINGDVEKRACGSLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTDEEIDHAIETIKESIGNLREMSPLWEMFKDGIDLDSVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.981 kDa

MKLPIYLDYAATTPVDPRVAEKMMQYMTMDGIFGNPASRSHRYGWQAEEAVDIARNQVAELINADPREIVFTSGATESDNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPESNGIIPIEKLEAAMREDTILLSLMHVNNEIGVIHDIDAIGELCRAKKVIFHVDAAQSAGKLPIDLQKSKVDLMSISAHKMYGPKGIGALYVRRKPRIRLEATMHGGGHERGMRSGTLATHQIVGMGEAAAIAKADMESDNARIRRLRDRLWDGIKHIEETYINGDAEQRYCGSLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLDDEMAHSSIRFSIGRFTTEEEIDHAIETITKSIGQLREMSPLWEMFKDGVDLSTVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.86 kDa

MKLPIYLDYAATTPVDPRVAEKMFQYMTMDGIFGNPASRSHRYGWQAEEAVDVARNQVADLINADHREIVFTSGATESNNLAIKGVAHFYKKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPESNGIIPMARLEAAMRDDTILVSIMHVNNEIGVIHDIDAIGELCRSKGIIFHMDAAQSAGKLPIDVQATKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEASAIAKAEMATDNVRIAKLRDKLWNGIKHIEETYVNGDMNQRTSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIEVITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.122 kDa

MKLPIYLDYAATCPVDERVVKKMMEFLSIDGNFGNPASRSHKFGWQAEEAVDVARNHIADLIGADSREIVFTSGATEADNLALKGVMRFYQTKGKHLITCKTEHKAILDTCRQLEREGFEVTYLDPKSDGLIDLEELKSVIRDDTVLVSIMHANNEIGVVQDIAKIGEICRERKVLFHTDATQSVGKLPINLSELKVDLLSMSSHKLYGPKGIGALYVCRKPRVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMPRLTALRDRLYNGLKDIEETYVNGSMEQRLGNNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTVGRYTTEEEIDYSIGLVKSAVKKLRDLSPLWDMFKEGIDLNSIEWTHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.087 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTMDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMESEMARLRGLRDRLWNGVKDMEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMTDELAHSSIRFSLGRFTTEEEIDYTINLVRNSIGRLRDLSPLWEMFKQGVDLNSIEWSHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.056 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTMDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQSNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMESEMARLRTLRNRLWNGVKDMEEVYLNGDLEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMTDELAHSSIRFSLGRFTTEEEIDYAIDLIRKSIGRLRELSPLWEMFKQGVDLNSIEWSHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.003 kDa

MKFPIYLDYAATCPADDRVAEKMMQYLTRDGIFGNPASRSHKFGWQAEEAVDIARNHIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITCKTEHKAVLDTCRQLEREGFEVTYLAPKSDGLVDLDEFRAAIRPDTILASIMHVNNEIGVIQDIEAIGKICREHKVIFHVDATQSVGKLPINLAELPVDLMSMSGHKLYGPKGIGALYVRRKPRVRLEAIIHGGGHERGMRSGTLAVHQIVGMGEAYRICKEEMAEEMAHVTKLRDRLYNGLKDIEETYVNGSMEHRVGSNLNISFNFVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRYTTEEEIDYTIDLVKSAVKKLRDLSPLWDMFKEGIDMSKIEWSAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.336 kDa

MAIHNCEGENVSTENKAVYMDNSATTPVRKEVVEAMLPYMTENFGNPSSIYEIGKTSKHAINLARKKAADALGAEENEIYFTSGGTESDNWAIKGIAFANRDKGKHIITSSIEHHAVLHTCAWLEGQGFEVTYLPVDKYGMVSPDELRNAIRDDTILISIMFANNEIGTIQPIKEIGEIAKENQIYFHTDAVQAIGHVPIDVKKLNIDLLSLSGHEFEGPKGCGALYIRKGVKIDPLLHGGAQERKRRAGTENVPGIVGLGKATELATAEIEESNRTLLKLRDRLIEGLLKIPKTHLNGHPTQRLANNVNVTFEYIEGESLLLLLNAKGIYASTGSACNSSSLEPSHVLTACGVPHEIIHGSLRLSLGRMNTSEDVDRVLEVVPEIVQKLRNMSPLTPKEYRTL

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.578 kDa

MTVKTPVYLDYAATTPVDKRVAEKMIPYLTETFGNPASNSHAFGWTAEEAVEKARADIAALINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKTEHKAVLDTMRELERQGFEVTYLGVQENGLIDLEELKAAIRDDTILISIMWVNNEIGVVQNIPAIGEICRERKIAFHVDAAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDIFLKGIEGIEEVYINGDLEHRAPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.578 kDa

MTVKTPVYLDYAATTPVDKRVAEKMIPYLTETFGNPASNSHAFGWTAEEAVEKARADIAALINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKTEHKAVLDTMRELERQGFEVTYLGVQENGLIDLEELKAAIRDDTILISIMWVNNEIGVVQNIPAIGEICRERKIAFHVDAAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDIFLKGIEGIEEVYINGDLEHRAPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.738 kDa

MTVKTPVYLDYAATTPVDKRVAEKMIPYLTETFGNPASNSHAFGWEAEEAVEKARADIAALINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKTEHKAVLDTMRELERQGFEVTYLGVQENGLIDLEELKAAIRDDTILISVMWVNNEIGVVQDIPAIGEICRERKIVFHVDAAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELEQDMAHYRKLRDIFLKGIEGIEEVYVNGDLEHRAPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.742 kDa

MTVKTPVYLDYAATTTVDKRVAEKMIPYLTETFGNPASNSHAFGWEAEEAVEKARADIAALINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKTEHKAVLDTMRELERQGFEVTYLGVQENGLIDLEELKAAIRDDTILVSVMWANNEIGVVQDIPAIGEICRERKIVFHVDAAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELEQDMAHYRKLRDIFLKGIEGIEEVYINGDLEHRVPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.647 kDa

MTVKTPVYLDYAATPPVDKRVAEKMIPYLTETFGNPASNSHSFGWEAEEAVEKARADIAALINADSKEIVFTSGATESNNLAIKGAAHFYKSKGNHLITVKTEHKAVLDTMRELERQGYEVTYLDVQENGLVDLDVLKAAIREDTILVSVMWVNNEIGVVQDIPAIGEICRERKIIFHVDAAQACGKVPVDVEAAKVDLLSMSGHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELAQDTAHYLKLRDIFLKGIEGIEEVYINGDLEHRVPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.724 kDa

MTVKTPVYLDYAATTPVDKRVAEKMIPYLTETFGNPASNSHAFGWEAEEAVEKARADIAALINADPKEIVFTSGATESDNLAIKGAANFYKTKGKHLITVKTEHKAVLDTMRELERQGFEVTYLGVQENGLIDLEELKAAIRDDTILISVMWANNEIGVVQDIPAIGEICRERKIVFHVDAAQACGKVPVDVEAAKIDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELEQDMAHYRKLRDIFLKGIEGIEEVYINGDLEHRAPNNLNVSFNFVEGESLIMAVKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSLRITFGRMTTEEEVQFAAELIKSKIGKLRELSPLWEMFKDGIDLNSIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.169 kDa

MKLPIYLDYAATCPVDERVAKKMMEYLTVEGNFGNPASRSHKFGWQAEEAVDVARNYIADLIGADSREIVFTSGATESDNLAIKGAAHFYQSKGKHIITCKTEHKAVLDTCRQLEREGFEVTYLNPKSDGLIDLEELKNAMRDDTILVSIMHVNNEIGVIQDIAAIGELCRARKILFHVDATQSVGKLPINLAELKVDLMSMSSHKLYGPKGIGALYVSRKPRVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRICKEEMASEMPRLKALRDRLYNGLKDIEETYVNGSMEHRLDSNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTLGRYTTEEEIDYTIELVKNAVAKLRELSPLWDMFKEGIDLNTIEWTHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.95 kDa

MKLPIYLDYSATTPVDPRVAEKMMQCLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATEADNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFDVTYLAPQRNGIIDLVELEAAMREDTILVSIMHVNNEIGVVQDIAAIGEMCRSRGIVFHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMTAEMDRLSMLRDRLWNGINDIEEVYLNGDIEQGVPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMFKQGVDISSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.134 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQIAELVGADPREIVFTSGATEADNLAIKGVANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLAELEAAMREDTILVSIMHVNNEIGVVQDIETIGEMCRSRGIVFHVDATQSVGKLPIDLNQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMTAEMDRLRTLRDRLWNGINDIEEVYLNGDIEQGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMFKQGVDISSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.1 kDa

MKLPIYLDYSATTPVDPRVAEKMMNYLTRDGIFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQSNGLIDLNDLEAAVRDDTILISIMHVNNEIGVVQDIAAIGEMCRSRGIVFHVDATQSVGKLPIDLTKLKVDLMSFSAHKIYGPMGIGALYVRRKPRIRIEAQQHGGGHERGMRSGTLPVHQIVGMGEAYRIAKQEMESESQRLRGLRLRLWQGIKDIEEVFLNGDLEHGAPHILNVSFNYVEGESLMMSLKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYAIELIHKSIGRLRELSPLWEMFRQGVDLNSIEWSHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.045 kDa

MKLPIYFDYSATCPVDPRVAEKMMQCLTMDGNFGNPASRSHRFGWQAEEAVDTAREQVADLMNADPREIVFTSGATESDNLAIKGAARFYSKKGKHIITCKTEHKAVLDPCRQLEREGFEVTYLDPEANGLIDMAKLRDAIREDTVLMSIMHVNNEIGVIQDITAIGELCRENKIVFHVDAAQSIGKLPIDVQAMKVDLISVTSHKIYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMEQDRVHTLALRTRLLDGLKDMESVHINGDLEQRVSSNLNISFAFVEGESLLMALKDLAVSSGSACTSASLEPSYVLRALGLDDELAHSSIRFSFGRFSTEEEIDYAITQIRTAVEKLRDMSPLWDMHKEGIDLNSVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.904 kDa

MKLPIYLDYSATTPVDPRVAEKMMQCLTIDGIFGNPASRSHRFGWQAEEAIDIARNQIADLIGADPREIVFTSGATEADNLALKGVANFYQKKGKHIITSKTEHKAILDTCRQLEREGFEVTYLAPKSDGLIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGELCRSKGIIYHVDATQSVGKLPIDLSKLKVDLLSLSAHKVYGPMGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLAVHQIVGMGEAYRILKEEMADETKRLNELRLRLWNGIKDIEEVYINGSLEHTAPNILNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLTDELAHSSIRFSLGRFTTEEEIDYAIEQIHSAIGRLRDLSPLWEMHKQGVDINSIEWSHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.868 kDa

MKLPIYFDYSATTPVDKRVAEKMMQYMTNDGHFGNPASRSHKFGWQAEEAVDIARNQIAELINADPREIVFTSGATESNNLAIKGAANFYNKKGKHIITCKTEHKAVLDTCRELERQGFEVTYLDPEENGLIDLNKLNDAMRDDTILVSIMQVNNEIGVIQDISEIGEMCRARKIVFHVDAAQSAGKINIDMQALKVDLMSISAHKMYGPKGIGALYVSRKPRIRLEAQTHGGGHERGMRSGTLATHQIVGMGEACRLAKEEMAQDQAHVTAMRDRLWAGLNSMEQVFINGDADKRYPGNLNVSFNFVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSFGRFTTTEEIDYAIELIKGAIGHLRDMSPLWEMFKDGIDLDSIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.07 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFLTMDGTFGNPASRSHRFGWQAEEAVDIARNQVADLIGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQSNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVDATQSVGKLPIDLTQLKVDLMSFTGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMASEMERLRGLRNRLWNGIKDIEEVYLNGDLEQGVPTILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMFKQGVDLTTIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis (biotin, thiamine, molybdopterin). Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine, then delivers the sulfur to an acceptor protein such as CyaY, IscU, IscX, MoaD/MoeB, ThiI, or TusA. Transfers sulfur to acceptor proteins via a transpersulfidation reaction; the flexibility of the persulfide sulfur-carrying Cys-328 allows it to reach different partners docked on the homodimer surface. May function as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.452 kDa

MKLPIYLDYSATTPVDPRVAQKMIDCLTVEGNFGNPASRSHVFGWKAEEAVENARRQVADLVNADPREIVWTSGATESNNLAIKGVAHFYASKGKHLITSKVEHKAVLDTTRQLEREGFEVTYIEPGEDGLITPAMIEAALRDDTILVSIMHVNNEIGTINDIAAIGELTRSRGVLFHVDGAQSTGKVEIDLASLKVDLMSFSAHKTYGPKGIGALYVSRKPRVRLEATMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMAAENVRIKALSDRFFKQVENLEELYVNGSLTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFSTEEEIDYAAQKVCEAVTRLRTLSPLWDMFKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.681 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLMDGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYSGKGKHIITSKIEHKAVLDTCRQLEREGFEVTYLEPGEDGLITPAMVEAALRDDTILVSVMHVNNEIGTINDIAAIGELTRSRGVLFHVDAAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEGQMHGGGHERGMRSGTLATHQIVGMGEAFRIAREEMAQESAHVLALRDRFFAQIDGLEELYINGSMTSRVPHNLNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAQKVVEAVSKLRELSPLWDMYKEGVDLSQVEWQAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.657 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLMDGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYSGKGKHIITSKIEHKAVLDTCRQLEREGFEVTYLEPGEDGLITSALVEAALRDDTILVSVMHVNNEIGTVNDIAAIGELTRSRGVLFHVDAAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEGQMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMAQENARVLALRDRFFAQIDGLEELYINGSMTSRVPHNLNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAKKVVEAVSKLRELSPLWDMYKEGVDLSQVEWQAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.667 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLMDGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYSGKGKHIITSKIEHKAVLDTCRQLEREGFEVTYLEPGEDGLITPALVEAALRDDTILVSVMHVNNEIGTVNDIAAIGELTRSRGVLFHVDAAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEGQMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMAQENARVLALRDRFFAQIDGLEELYINGSMTSRVPHNLNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAKKVVEAVSKLRELSPLWDMYKEGVDLSQVEWQAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.667 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLMDGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYSGKGKHIITSKIEHKAVLDTCRQLEREGFEVTYLEPGEDGLITPALVEAALRDDTILVSVMHVNNEIGTVNDIAAIGELTRSRGVLFHVDAAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEGQMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMAQENARVLALRDRFFAQIDGLEELYINGSMTSRVPHNLNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAKKVVEAVSKLRELSPLWDMYKEGVDLSQVEWQAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.441 kDa

MKLPIYLDYSATTPVDPRVAQKMAECLLVDGNFGNPASRSHVFGWKAEEAVENGRRQVAELINADPREIVWTSGATESDNLALKGVAHFYQTKGKHIITSKIEHKAVLDTARQLEREGFEVTYLEPGEDGIVTPAMVEAALRDDTILVSLMHVNNEVGSINDIAAIGELTRSRGVLFHVDAAQSAGKVEIDVQKLKVDLMSFSAHKVYGPKGIGALYVSRKPRVRLEAIIHGGGHERGMRSGTLPTHQIVGMGEAFAIAKQEMAAENVRIKALSDRFFKQVSDLEELYVNGSQTARVPHNLNLSFNYVEGESLLMSLKDIAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFSFGRFTTEEEVDYAAQEVCKAVNKLRELSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.575 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKAEESVENARRQVADLVNADPREIVWTSGATESDNLAIKGVAHFYHTKGKHLITSKIEHKAVLDTMRQLEREGFEVTYIEPGEDGLITPAMVEAALRDDTILVSIMHVNNEIGTINDIAAIGELTRSKGVLFHVDGAQSTGKVDIDLQALKVDLMSFSAHKTYGPKGIGALYVSRKPRVRLEATMHGGGHERGMRSGTLATHQIVGMGEAFHVAKEDMAAENLRIKALSDRFYKQVEHLEELYINGSMTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAQKVCEAVTKLRALSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.495 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKAEEAVENARRQVADLVNADPREIVWTSGATESDNLAIKGAAHFYATKGKHLITTKIEHKAVLDTMRQLEREGFEVTYLEPTTDGIVTPAMIEAALREDTILVSVIHVNNEIGTINDIAAIGELTRSKGILLHVDAAQSTGKVDIDLSKLKVDLMSFSAHKTYGPKGIGALYVSRKPRVRIEATMHGGGHERGMRSGTLATHQIVGMGEAFRVAKEDMAAENVRIKALSDRFYKQVENLEELYINGSMTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEQVDYAAQKVCEAVNKLRVLSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.611 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYASKGKHIITSKIEHKAVLDTTRQLEREGFEVTYLEPGEDGLITPAMVEAALRDDTTLVSVMHVNNEIGTINDIAAIGELTRSRGVLLHVDAAQSTGKVEIDLEKMKVDLMSFSAHKTYGPKGVGALYVRRKPRVRLEAQTHGGGHERGMRSGTLATHQCVGMGEAFRIAKEDMAAENQRITALRDRFYRQLEGMEELYVNGSLTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEVDYAAAKVREAVDKLRELSPLWDMFKEGVDLSSVEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.469 kDa

MKLPIYLDYSATTPVDPRVAQKMADCLLVDGNFGNPASRSHVFGWKAEEAVENGRRQVAELINADPREIVWTSGATESDNLALKGVAHFYQTKGKHIITSKIEHKAVLDTARQLEREGFEVTYLEPGEDGIVTPAMVEAVLRDDTILVSLMHVNNEVGSINDIAAIGELTRSRGVLFHVDAAQSAGKVEIDLQKLKVDLMSFSAHKVYGPKGIGALYVSRKPRVRLEAIIHGGGHERGMRSGTLPTHQIVGMGEAFAIAKQEMVAENARIKALSDRFFKQVSNLEELYVNGSQTARVPHNLNLSFNYVEGESLLMSLKDIAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFSFGRFTTEEEVDYAAQKVCEAVNKLRELSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.599 kDa

MKLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKAEESVENARRQVADLVNADPREIVWTSGATESDNLAIKGAAHFYASKGKHLITSKIEHKAVLDTMRQLEREGFEVTYLDPTEDGLITPAMIEAALREDTILVSVMHVNNEIGTVNDIAAIGELLRSKGILFHVDAAQSTGKVEIDLQKLKVDMMSFSAHKTYGPKGIGALYVSRKPRVRIEATMHGGGHERGMRSGTLATHQIVGMGEAFRVAKEDMAAENVRIKALSDRFYKQVEHLEELYVNGSLTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAQKVCEAVTKLRALSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.469 kDa

MKLPIYLDYSATTPVDPRVAQKMADCLLVDGNFGNPASRSHVFGWKAEEAVENGRRQVAELINADPREIVWTSGATESDNLALKGVAHFYQTKGKHIITSKIEHKAVLDTARQLEREGFEVTYLEPGEDGIVTPAMVEAVLRDDTILVSLMHVNNEVGSINDIAAIGELTRSRGVLFHVDAAQSAGKVEIDLQKLKVDLMSFSAHKVYGPKGIGALYVSRKPRVRLEAIIHGGGHERGMRSGTLPTHQIVGMGEAFAIAKQEMVAENARIKALSDRFFKQVSDLEELYVNGSQTARVPHNLNLSFNYVEGESLLMSLKDIAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFSFGRFTTEEEVDYAAQKVCEAVNKLRELSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.469 kDa

MKLPIYLDYSATTPVDPRVAQKMADCLLVDGNFGNPASRSHVFGWKAEEAVENGRRQVAELINADPREIVWTSGATESDNLALKGVAHFYQTKGKHIITSKIEHKAVLDTARQLEREGFEVTYLEPGEDGIVTPAMVEAVLRDDTILVSLMHVNNEVGSINDIAAIGELTRSRGVLFHVDAAQSAGKVEIDLQKLKVDLMSFSAHKVYGPKGIGALYVSRKPRVRLEAIIHGGGHERGMRSGTLPTHQIVGMGEAFAIAKQEMVAENARIKALSDRFFKQVSNLEELYVNGSQTARVPHNLNLSFNYVEGESLLMSLKDIAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFSFGRFTTEEEVDYAAQKVCEAVNKLRELSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.453 kDa

MKLPIYLDYSATTPVDPRVAQKMADCLLVDGNFGNPASRSHVFGWKAEEAVENGRRQVAELINADPREIVWTSGATESDNLAIKGVAHFYQSKGKHIITSKIEHKAVLDTARQLEREGFEVTYLEPGEDGIVTPAQVEAVLRDDTILVSLMHVNNEVGSINDIAAIGELTRSRGVLFHVDAAQSAGKVEIDLQKLKVDLMSFSAHKAYGPKGIGALYVSRKPRVRLEAIIHGGGHERGMRSGTLPTHQIVGMGEAFAIAKQEMAAENQRIKALSDRFFKQVSDLEELYVNGSQTARVPHNLNLSFNYVEGESLLMSLKDIAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFSFGRFTTEEEVDYAAQKVCEAVNKLRELSPLWDMYKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.384 kDa

MKLPIYLDYSATTPVDPRVAQKMIECLTVEGNFGNPASRSHVFGWKAEEAVENARRQVADLVSADPREIVWTSGATESNNLAIKGVAHFYASKGKHLITSKVEHKAVLDTTRQLEREGFEVTYIEPGEDGLITPSMIEAALRDDTILVSIMHVNNEIGTINDIAAIGELTRSRGVLFHVDGAQSTGKVEIDLASLKVDLMSFSAHKTYGPKGIGALYVSRKPRVRLEAAMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMAAESVRIKALSDRFYKQVENLEELYVNGSLTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFSTEEEIDYAAQKVCEAVTRLRALSPLWDMFKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.452 kDa

MKLPIYLDYSATTPVDPRVAQKMIDCLTVEGNFGNPASRSHVFGWKAEEAVENARRQVADLVNADPREIVWTSGATESNNLAIKGVAHFYASKGKHLITSKVEHKAVLDTTRQLEREGFEVTYIEPGEDGLITPAMIEAALRDDTILVSIMHVNNEIGTINDIAAIGELTRSRGVLFHVDGAQSTGKVEIDLASLKVDLMSFSAHKTYGPKGIGALYVSRKPRVRLEATMHGGGHERGMRSGTLATHQIVGMGEAFRIAKEEMAAENVRIKALSDRFFKQVENLEELYVNGSLTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFSTEEEIDYAAQKVCEAVTRLRTLSPLWDMFKDGVDISKIEWAAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.962 kDa

MKLPIYLDYSATTPVDPRVAEKMIECLTNEGNFGNPASRSHAFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYASKGKHIVTTKIEHKAVLDTTRQLEREGFEVTYIEPGDDGIVTPAMVEAALREDTILVSVMHVNNEIGTINDITAIGELTRARGILFHVDAAQSTGKVEIDLEKIKVDLMSFSAHKTYGPKGVGALYVRRKPRVRLEAQMHGGGHERGMRSGTLATHQLVGMGEAFRIAKQEMAQENERIRALRDRFYKQVEHLEELYVNGSMTARVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEIDYAAQKVCEAVTKLRELSPLWDMFKDGVDISKVEWQAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.724 kDa

MKLPIYLDYAATTPVDPRVAEKMMQCLTMDGIFGNPASRSHRYGWQAEEAVDIARNQVAELINADPREIVFTSGATESDNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGYEVTYLQPEPSGLIPVSMIEAAMREDTILVSIMQVNNEIGVIQDIDAIGELCRSRKIIFHVDAAQSAGKLPIDVQTTKVDLMSISGHKMYGPKGIGALYVSRKPRIRLEAAMHGGGHERGMRSGTLATHQIVGMGEAAAIAKADMEVDNERIRRLRDKLWNGINHIEETYINGDVEKRACGSLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTDEEIDHAIETIKESIGNLREMSPLWEMFKDGIDLDSVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.935 kDa

MKLPIYLDYAATTPVDPRVAEKMFQYMTMDGIFGNPASRSHRYGWQAEEAVDIARNQVADLINADHREIVFTSGATESNNLAIKGVAHFYNKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPASNGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDIDAIGELCRSKGIIFHMDAAQSAGKLPIDVQATKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEAAAIAKAEMATDNERIGRLRDKLWNGIKHIEETYINGDLTQRFCGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.882 kDa

MKLPIYLDYAATTPVDPRVAEKMMQCMTMDGIFGNPASRSHRYGWQAEEAVDIARNQIAELINADPREIVFTSGATESDNLAIKGVAHFYQKKGKHIITSKTEHKAVLDTCRQLEREGYEVTYLQPEANGLIPVAMIEAAMREDTLLVSIMQVNNEIGVIQDIDAIGELCRSRKIVFHVDAAQSAGKMPIDVQKTKVDLMSISAHKMYGPKGIGALYVSRKPRIRLEAAMHGGGHERGMRSGTLATHQIVGFGEAAAIAKTDMDSDNERIRRLRDKLWNGINHIEETYINGDMEQRHCGSLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTDEEIEHAIETITESIGNLREMSPLWEMFKDGIDLDSVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.803 kDa

MKLPIYLDYAATTPVDPRVAEKMFQYMTMDGIFGNPASRSHRYGWQAEEAVDVARSQVADLINADHREIVFTSGATESNNLAIKGVAHFYNKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPEANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDVDAIGELCRSKGIIFHMDAAQSAGKLPIDVQTTKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLATHQIVGLGEAAAIAKAEMATDNARIAKLRDKLWNGIKHIEETYVNGDMTHRVSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.692 kDa

MKLPIYLDYAATTPVDPRVAEKMMQCMTMDGIFGNPASRSHRYGWQAEEAVDIARNQVAELINADPREIVFTSGATESDNLAIKGVAHFYHKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPESNGLIPLETIEAAMREDTILVSIMHVNNEIGVIHDISAIGELCRSKKIIFHVDAAQSAGKLPIDVQSMKVDLISISAHKMYGPKGIGALYVRRKPRIRLEATMHGGGHERGMRSGTLATHQIVGMGEAAAIAKADMTTDNARIRTLRDRLWNGVKGIEETYINGDFEQSYCGSLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETINKSIGDLREMSPLWEMFQDGVDLDKVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.844 kDa

MKLPIYLDYAATTPVDPRVAEKMFQYMTMDGIFGNPASRSHRYGWQAEEAVDVARNQVAELINADHREIVFTSGATESNNLAIKGVAHFYNKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPEANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDVDAIGELCRSKGIIFHMDAAQSAGKLPIDVQTTKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLATHQIVGLGEAAAIAKAEMATDNARIAKLRDKLWNGIKHIEETYVNGDMTHRVSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.803 kDa

MKLPIYLDYAATTPVDPRVAEKMFQYMTMDGIFGNPASRSHRYGWQAEEAVDVARSQVADLINADHREIVFTSGATESNNLAIKGVAHFYNKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPEANGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDVDAIGELCRSKGIIFHMDAAQSAGKLPIDVQTTKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLATHQIVGLGEAAAIAKAEMATDNARIAKLRDKLWNGIKHIEETYVNGDMTHRVSGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.935 kDa

MKLPIYLDYAATTPVDPRVAEKMFQYMTMDGIFGNPASRSHRYGWQAEEAVDIARNQVADLINADHREIVFTSGATESNNLAIKGVAHFYNKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLEPASNGIIPMERLEAAMRDDTILVSIMHVNNEIGVIHDIDAIGELCRSKGIIFHMDAAQSAGKLPIDVQATKVDLISISGHKMYGPKGIGALYVRRKPRIRLEAQMHGGGHERGMRSGTLPTHQIVGLGEAAAIAKAEMATDNERIGRLRDKLWNGIKHIEETYINGDLTQRFCGSLNVSFNYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETITQSIDKLREMSPLWEMFKDGIDLNQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.526 kDa

MKLPIYLDYAATTPVDPRVAEKMMQCMTMDGIFGNPASRSHRYGWQAEEAVDIARNQVADLINADPREIVFTSGATESDNLAIKGVAHFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPEANGLIPLATIESAMREDTVLVSIMHVNNEIGVIHDINAIGELCRSKKIIFHVDAAQSAGKLPLDVQETKVDLLSISAHKMYGPKGIGALYVRRKPRIRLEAAMHGGGHERGMRSGTLATHQIVGMGEAAAIAKADMEADNARIAGLRDRLWNGVKGIEETYINGDVEQRYCGSLNVSFNFVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDEMAHSSIRFSIGRFTTEEEIDHAIETINKSIDSLRDMSPLWEMFKDGVDLEQVQWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur and selenium atoms from cysteine and selenocysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Also functions as a selenium delivery protein in the pathway for the biosynthesis of selenophosphate.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.09 kDa

MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRVRIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGAPNILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.475 kDa

MKLPIYLDYSATCPVDPRAAEKMMQCLTLDGNFGNPASRSHRFGWQAEEAVDEARNHVADLIGADPREIVFTSGATESNNLAIKGAAHFYVKQGKHIITCKTEHKAVLDTCRHLESEGYEVTYLDPQSDGLLTLPQIEAAMRPDTILVSIMHVNNEIGVIQDLAAIGELCRARKILFHVDAAQSAGKVEIDVDAMKIDLLSLSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGMRSGTLPTHQIVGMGEAFRIAKAEMAEENVRIKALRDRLYDGLKDIEQVFVNGSTEHRVAGNLNISFAYVEGESLMMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSIGRFTTAEEIDYAIGLIRDSIGKLRDLSPLWDMYKEGIDLSKVEWVSH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.964 kDa

MSIPTYMDYSATTPVDERVAQKMIQFLTKDGNFGNSASNSHYYGWQADEAVKKARQQVANLIDADPKEIVWTSGATESNNLAIKGVAHFYHKKGKHIITLKTEHKSVLDTCRQLEREGFEVTYLDPMSNGLLDLNILRDAMREDTILVSIMHVNNEIGVIQDIESIGNLCHQNNIFFHVDAAQSAGKVAISLSELSVDLMSFSAHKIYGPKGMGALYVRRKPRVRIEAQMHGGGHERGMRSGTLATHQIVGMGEAFAIAQAEMREENTKIRQLRDRLLVGFIDMEEVVVNGDMESRIPGNLNISFNYVEGESLMMAINDIAVSSGSACTSLSLEPSYVLRALGLNDELAHSSIRFTIGRYTTEAQIDKAIDLVRAKVDKLRDLSPLWDMFKDGVDISKVEWSAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.809 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIAALLNADPREIVFTSGATESDNLAIKGVAHFYNKQGKHIITSKTEHKAVLDTMRQLEREGFEVTYLDPESNGLVDLAKLEAAMRDDTILVSIMHVNNEIGVVQDIAAIGELCRSRKVVFHVDAAQSAGKVAIDVQEMKVDLISLSAHKAYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELQQDYDHALKLRNRLLDGIKDMEAVTINGDLDQRVPHNLNVSFAFVEGESLLMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSFGRFTTEAEIDYAIELIRVAVDKLRAMSPLWDMYKDGVDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.907 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIADLINADPREIVFTSGATESDNLAIKGAAHFYSKKGKHVITCKTEHKAVLDPCRQLEREGFEVTYLEPESNGLVDLSKLQAAMREDTVLVSIMHVNNEIGVIQDITAIGDLCRERKIVFHVDAAQSAGKLPIDVQEMKVDLISFSAHKAYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRVAKEDMQKDYDHALALRNRLLDGVKDLEAVTVNGDLEQRVPHNLNVSFAFVEGESLLMSLKDLAVSSGSACTSASLEPSYVLRALGLDDELAHSSVRFSFGRFTTEAEIDYAIEQIRVAVTKLRDMSPLWDMYKEGIDLSTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.809 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIAALLNADPREIVFTSGATESDNLAIKGVAHFYNKQGKHIITSKTEHKAVLDTMRQLEREGFEVTYLDPESNGLVDLAKLEAAMRDDTILVSIMHVNNEIGVVQDIAAIGELCRSRKVVFHVDAAQSAGKVAIDVQEMKVDLISLSAHKAYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELQQDYDHALKLRNRLLDGIKDMEAVTINGDLDQRVPHNLNVSFAFVEGESLLMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSFGRFTTEAEIDYAIELIRVAVDKLRAMSPLWDMYKDGVDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.823 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIAALLNADPREIVFTSGATESDNLAIKGVAHFYNKQGKHIITSKTEHKAVLDTMRQLEREGFEVTYLDPESNGLIDLAKLEAAMRDDTILVSIMHVNNEIGVVQDIAAIGELCRSRKVVFHVDAAQSAGKVAIDVQEMKVDLISLSAHKAYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLPTHQIVGMGEAFRIAKEELQQDYDHALKLRNRLLDGIKDMEAVTINGDLDQRVPHNLNVSFAFVEGESLLMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSFGRFTTEAEIDYAIELIRVAVDKLRAMSPLWDMYKDGVDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.995 kDa

MKLPIYLDYSATCPVDPRVAEKMVQYMTMDGTFGNPASRSHRYGWQAEEAVDTAREQIADLLNADPREIVFTSGATESDNLAIKGAAHFYSKKGKHVITCKTEHKAVLDPCRQLEREGFEVTYLEPESNGLIDLEKLKAAMRDDTVLVSIMHVNNEIGVIQDIAAIGELCRERKIVFHVDAAQSAGKLPIDVQEMKVDLISLSAHKVYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLATHQIVGMGEAFRIAKEEMQKDYDHALALRNRLLNGVKDLEAVTVNGDLEQRVPQNLNISFAFVEGESLLMSLKDLAVSSGSACTSASLEPSYVLRALGMDDELAHSSVRFSFGRFTTEEEIDYAIEQIRVAVTKLRDMSPLWDMYKEGVDLSTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.856 kDa

MKLPIYFDYSATCPVDPRVAEKMVQCMTMDGNFGNPASRSHRYGWQAEESVDNAREQIADLLNADPREIVFTSGATESDNLAIKGAAHFYEKKGKHVITCKTEHKAVLDPCRQLEREGFEVTYLEPEANGIIDLDKLQAAMREDTVLVSIMHVNNEIGVIQDIGAIGELCRARKIIFHVDAAQSAGKIPLDVKEMKVDLISMSAHKAYGPKGIGALYVRRKPRIRLEAQMHGGGHERGFRSGTLATHQIVGMGEAFAIAKQDMQKDYDHALALRERLLKGVQDLEAVTVNGDLDQRVPHNLNVSFAFVEGESLLMSLKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSVRFSFGRFTTEEEIDYAIAQIRVAVNKLRDMSPLWDMYKEGIDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.995 kDa

MKLPIYLDYAATCPVDERVAEKMMNYLTIDGVFGNPASRSHKFGWQAEEAVDIARNQIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITCKTEHKAVLDTCRQLEREGFEVTYLSPKCDGLIDLDEFKAAIRPDTILASIMHVNNEIGVIQDIRAIGEICRAHKIIFHVDATQSVGKIAINLAELSVDLLSMSGHKLYGPKGVGALYVRRKPRIRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRICKEEMATEMPRLKALRDRLYNGLKDIEETYVNGSMEHRVDSNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFTVGRYTTEEEIDYTIELVKSAVKKLRELSPLWDMFKEGVDMSKIEWSAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.805 kDa

MKLPIYLDYSATCPVDPRVAEKMMQCLTMDGLFGNPASRSHRFGWQAEEAVDLARNQVAELIGADPREIVFTSGATESNNLAIKGVAHFYAGKGKHIVTSKTEHKAVLDTCRQLEREGYEVTYLEPMPNGLFTLEQIEGALRDDTILVSIMHVNNEIGVVQNIAAIGELCRSRKILLHVDAVQSVGKIPVDVEALKVDLLSMSAHKVYGPKGIGALYVRRKPRVRLEAQMHGGGHERGMRSGTLPTHQIVGMGEAFRIAKEEMVSEGQRIMALRQRLWDGIKDIEAVYINGDLEQRVPGNLNVSFAYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSMGRFTTEEEIDYAIKLIRDSIGRLREMSPLWEMYKDGVDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.706 kDa

MKLPIYLDYSATCPVDPRVAEKMMQCLTMDGLFGNPASRSHRFGWQAEEAVDLARNQVAELLGADPREIVFTSGATESNNLAIKGVAHFYAGKGKHIITSKTEHKAVLDTCRQLEREGYEVTYLEPMPNGLFTLEQIEGALRDDTILVSIMHVNNEIGVVQNIAAIGELCRSRKILLHVDAVQSVGKIPVDVEALKVDLLSVSAHKVYGPKGIGALFVRRKPRVRLEAQMHGGGHERGMRSGTLPTHQIVGMGEAFRIAKEEMASEGQHIMALRQRLWDGIKDIEAVYINGDLEQRVPGNLNVSFAYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYAIKLIRDSIGRLREMSPLWEMYKDGVDLNTVEWAHH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.171 kDa

MKIPIYMDYHATTPVDPRVLEAMLPYFTTEYGNAASKSHAFGWKAEEAVEAAREEVAKLIGASAKEIVWTSGATESDNLAVKGAAHFYQAKGKHLVTCKTEHKAVLDSMHALERQGFEVTFLEPERDGRLDPAKVQAALRPDTILVSVMHANNETGVVHPIAEIGRIARGAGVVFHCDAVQSIGKIPFDVEAMNVDLASISAHKMYGPKGMGALYVRRKPRVRLVAEMDGGGHERGFRSGTLNVPGIVGMGKAAELARLERDAEAVRVTALRERLRKGLEKELDLLTVNGSLEHRVPGNLNVSFAYVEGEALMMAVKDVAVSSGSACTSASLEPSYVLRAMGVSEDLAHSSIRFGLGRFSTEEEVDYTIRLFGEKVRKLREMSPLYEMVKDGVDLNQIEWANPH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.181 kDa

MKIPIYMDYHATTPVDPRVLEAMLPYFTTEYGNAASKSHAFGWKAEEAVEAAREEVAKLIGASAKEIVWTSGATESDNLAVKGAAHFYQAKGKHLVTCKTEHKAVLDSMHALERQGFEVTFLEPERDGRLDPAKVKAALRPDTILVSVMHANNETGVVHPIAEIGRIAREAGVVFHCDAVQSIGKIPFDVEAMNVDLASISAHKMYGPKGVGALYVRRKPRVRLVAEMDGGGHERGFRSGTLNVPGIVGMGKAAELARLERDAEAVRVTALRERLRKGLEQELDLLTVNGSLEHRVPGNLNVSFAYVEGEALMMAVKDVAVSSGSACTSASLEPSYVLRAMGVSEDLAHSSIRFGLGRFSTEEEVDYAIRLFGEKVRKLREMSPLYEMVKDGVDLNQIEWANPH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.056 kDa

MKIPIYMDYHATTPVDRRVLEAMLPYFAEDFGNAASKSHAFGWRAEEAVEAAREEVARLVGASAKEIVWTSGATESDNLAVKGAAQFYQSKGKHLVTCKTEHKAVLDSMHALERQGFEVTFLDVEKDGRLDPARLRAALREDTILVSIMHANNETGVVHPIEEIGRITRAAGVLFHCDAVQSAGKLPFDVEDANVDLASLSAHKMYGPKGVGALYVRRKPRVRLIAQMDGGGHERGFRSGTLNVPGIVGFGKAAELARLEGAAEAERVLALRERLRKGLDAGLDLLTVNGSLAHRVPGNLNVSFAYVEGEALMMAIKDVAVSSGSACTSASLEPSYVLRAMGISEDLAHSSIRFGLGRFTTEEEVDHVVRLVVEKVRKLREMSPLYEMVKEGVDLSQIEWANPH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.213 kDa

MKIPIYMDYHATTPVDPRVLEAMLPYFTTEYGNAASKSHAFGWKAEEAVEAAREEVAKLIGASAKEIVWTSGATESDNLAVKGAAHFYQAKGKHLVTCKTEHKAVLDSMHALERQGFEVTFLEPERDGRLDPAKVKAALRPDTILVSVMHANNETGVVHPIAEIGRIAREAGVVFHCDAVQSIGKIPFDVEAMNVDLASISAHKMYGPKGMGALYVRRKPRVRLVAEMDGGGHERGFRSGTLNVPGIVGMGKAAELARLERDAEAVRVTALRERLRKGLEKELDLLTVNGSLEHRVPGNLNVSFAYVEGEALMMAVKDVAVSSGSACTSASLEPSYVLRAMGVSEDLAHSSIRFGLGRFSTEEEVDYAIRLFGEKVRKLREMSPLYEMVKDGVDLNQIEWANPH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.649 kDa

MKLPIYLDYSATTPVDPRVAQKMCECLTMEGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYASKGKHIITSKIEHKAVLDTTRQLEREGFEVTYLEPGEDGLITPAMVAAALREDTILVSVMHVNNEIGTVNDIAAIGELTRSRGVLYHVDAAQSTGKVAIDLERMKVDLMSFSAHKTYGPKGIGALYVRRKPRVRLEAQMHGGGHERGMRSGTLATHQIVGMGEAFRIAREEMAAESRRIAGLSHRFHEQVSTLEEVYLNGSATARVPHNLNLSFNYVEGESLIMSLRDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEVDYAARKVCEAVGKLRELSPLWDMYKDGVDLSKIEWQAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur from cysteine to produce alanine via an enzyme-bound persulfide intermediate. Functions as a sulfur delivery protein for Fe-S cluster synthesis. Cluster assembly on IscU homodimers proceeds sequentially from 1 2Fe-2S per dimer, to 2 2Fe-2S per dimer and finally 1 4Fe-4S per dimer.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.6 kDa

MKLPIYLDYSATTPVDPRVAQKMCECLTMEGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFNASKGKHIITSKIEHKAVLDTTRQLEREGFEVTYLEPGEDGLITPAMVAAALREDTILVSVMHVNNEIGTVNDIAAIGELTRSRGVLYHVDAAQSTGKVAIDLERMKVDLMSFSAHKTYGPKGIGALYVRRKPRVRLEAQMHGGGHERGMRSGTLATHQIVGMGEAFRIAREEMAAESRRIAGLSHRFHEQVSTLEEVYLNGSATARVPHNLNLSFNYVEGESLIMSLRDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRFTTEEEVDYAARKVCEAVGKLRELSPLWDMYKDGVDLSKIEWQAH

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.161 kDa

MKTPIYLDYAATTPVEFEVAKKMMNYLTIDGVFGNSASRSHKFGWKAEEVVDIARNQISELIGADSREIVFTSGATESNNLAIKGIASFHQNKGKHIVTSKTEHKSVLDTCRYLENKGFTVTYLTPKNNGIIDLNNLKKNIKKDTILVSIMHVNNEIGIIQDINSISQICRNHGVFFHVDATQSVGKIPIDLKKIPIDLMSFSAHKIYGPKGIGGLYVRRKPRVRLLSLIHGGGHERGMRSGTLPVHQIVGMGESFVLAKRKIHDDFIHLTKLKNILWNGIKNIEEVYLNSDLQQGAPHILNVSFNYVEGESLIMALKDLAISSGSACTSASLEPSYVLKSLGIRDELAHSSIRFSIGRFTTEKEIIHAIKLVHKSIHRLRELSPLWEMFKSGVDLNSIEWDHV

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.161 kDa

MKTPIYLDYAATTPVEFEVAKKMMNYLTIDGVFGNSASRSHKFGWKAEEVVDIARNQISELIGADSREIVFTSGATESNNLAIKGIASFHQNKGKHIVTSKTEHKSVLDTCRYLENKGFTVTYLTPKNNGIIDLNNLKKNIKKDTILVSIMHVNNEIGIIQDINSISQICRNHGVFFHVDATQSVGKIPIDLKKIPIDLMSFSAHKIYGPKGIGGLYVRRKPRVRLLSLIHGGGHERGMRSGTLPVHQIVGMGESFVLAKRKIHDDFIHLTKLKNILWNGIKNIEEVYLNSDLQQGAPHILNVSFNYVEGESLIMALKDLAISSGSACTSASLEPSYVLKSLGIRDELAHSSIRFSIGRFTTEKEIIHAIKLVHKSIHRLRELSPLWEMFKSGVDLNSIEWDHV

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.144 kDa

MKNPIYLDYAATTPVEFKVAKKMMNYLTIDGIFGNPASRSHKFGWEAEEVIDIARNEISELIGSDSREIVFTSGATEANNLAIKGIAFFHRKKGNHIITSKTEHKSVLDACRYLESVGFSVTYLTPKNNGIIDLNDLKKNINKNTILVSIMHVNNETGIIQDITNISKICRSHDIFFHVDATQSVGKIAINLKNLFVDLMSFSAHKIYGPKGIGGLYVRRKPRVRLSALSHGGGHERGMRAGTLPVHQIVGMGESFKLARKKINDDFIHLTNLRNDLWNGIKNIEEVYLNSDLKQGAPHILNVSFNYIEGESLIMALKDLAISSGSACTSSSLEPSYVLRALGIKDELAHSSIRFSIGRFTTKEEIQHTVKSVHKSIHRLRALSPLWEMFKSGVDLNSIEWDHT

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.161 kDa

MKTPIYLDYAATTPVEFEVAKKMMNYLTIDGVFGNSASRSHKFGWKAEEVVDIARNQISELIGADSREIVFTSGATESNNLAIKGIASFHQNKGKHIVTSKTEHKSVLDTCRYLENKGFTVTYLTPKNNGIIDLNNLKKNIKKDTILVSIMHVNNEIGIIQDINSISQICRNHGVFFHVDATQSVGKIPIDLKKIPIDLMSFSAHKIYGPKGIGGLYVRRKPRVRLLSLIHGGGHERGMRSGTLPVHQIVGMGESFVLAKRKIHDDFIHLTKLKNILWNGIKNIEEVYLNSDLQQGAPHILNVSFNYVEGESLIMALKDLAISSGSACTSASLEPSYVLKSLGIRDELAHSSIRFSIGRFTTEKEIIHAIKLVHKSIHRLRELSPLWEMFKSGVDLNSIEWDHV

iscS

Cysteine desulfurase IscS

404 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

45.678 kDa

MKFPIYLDYAATTPVEFEVMKEMMNYLTLEGEFGNPASRSHKFGWKAEEAVDIARNQIAELIHADSREIIFTSGATESNNLAIKGIAEFYKKKGNHIITCSTEHKATLDTCRYLENKGFDITYLNPLQNGTINIYELQEKIQKNTILVSIMHVNNEIGVIQDIHKISKICQSNNILFHVDAAQSIGKININLKQLKIDLMSFSAHKIYGPKGIGGLYIRRKPRVRLSAQIHGGGHEKGMRSGTLPVHQIVGMGIAYKIAKIKINSDFNYIKHLRNRLWNGIKNIEEIHLNSNFENTVPHILNVSFNYVEGESLIMALKNLAVSSGSACTSSSLEASYVLRSLGLKDELAHSSIRFSLGRFTTKEEIDYTIQLIHQSINRLRNLSPLWEMFKSGVDMNNVNWTHN

iscS

Cysteine desulfurase IscS

403 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.565 kDa

MKLPVYLDYSATTPVDPRVAEKMIPFLTENFGNPASRSHTFGWTAEQAVENAREEVAKLVNADPREIVWTSGATESDNLAIKGAAEFYQTKGRHLITVKTEHKAVLDTMRELESSGFEVTYLEPMANGLLDLDAFRAAIRPDTVLASVMQVNNEIGVIQDIAAIGGICREHGVIFHVDAAQATGKVEIDLEQLPVDLMSFSAHKTYGPKGIGALYVRRKPRIRLKAQMHGGGHERGLRSGTLATHQIVGMGEAFRIAREEMAAENERIRRLRDRLLAGLADMEEVFINGDLEQRVPHNLNISFNYVEGESLMMAIKDLAVSSGSACTSASLEPSYVLRALGRSDELAHSSIRFTLGRYTTAEDVDFAISLIKDKVARLREISPLWEMYKDGIDLNTVQWAAAH

iscS

Cysteine desulfurase IscS

403 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.765 kDa

MKLPIYLDYSSTTPVDPRVAEKMMQYLTPGGEFGNPASRSHRFGWHAEEAVDVAREQIADLISGDPREIVFTSGATESNNLAIKGAAHFYVKKGKHIITAKTEHKAVLDTCRQLEREGYEVTYLDPKEDGIVTPQQLKEVLRPDTVLVSLMHVNNEIGVIQDIAGFGELCRANKTIFHVDASQSVGKIEIDTQALKVDLMSFSAHKIYGPKGIGALYVSRKPRVRLEAQMHGGGHERGMRSGTLPTHQIAAMGEAFRIAKEEMASDEVRILALRTRLLNGVNDMEEVYVNGSLENRIAGNINISFNYVEGESLVMALKDLAVSSGSACTSASLEPSYVLRAIGRDDELAHSSIRFSIGRFTTEEEIDYAINIIRKNIGRLRDMSPLWDMYKEGIDIKSIEWSH

iscS

Cysteine desulfurase IscS

397 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.107 kDa

MNKQVYMDYSATTYTKPEVLEEMLPFFTENFGNPSSLYSFSDKTKKAVNLARERVSKALNAEKNEIFFTSGGSEADNWAIKGIAYANKKKGNHIITTKIEHHAILHTAQFLEKEGFKVTYLPVDEEGFVSVEDIKNAITDETILVSVMFANNEIGTIEPIKEIGELCKEKNIYFHTDAVQAIGHVDIDVKDMNIDLLSMSAHKFYGPKGVGALYIKNGVKIQNLIHGGGQERGKRASTENTAGIVGLGKAIELAMENMPEENEKLSNLRGRLIRGIEARIPEVKLNGPKDMSRRLPNNVNFSFIGIEGETLLLDLDMNGIFGSTGSACASASLDPSHVLLSIGLPHETAHGSLRLSLGAKNTEEDIDYVLEVLPKIIKQRREMSPLWEDYMKNKEEK

iscS

Cysteine desulfurase IscS

397 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.107 kDa

MNKQVYMDYSATTYTKPEVLEEMLPFFTENFGNPSSLYSFSDKTKKAVNLARERVSKALNAEKNEIFFTSGGSEADNWAIKGIAYANKKKGNHIITTKIEHHAILHTAQFLEKEGFKVTYLPVDEEGFVSVEDIKNAITDETILVSVMFANNEIGTIEPIKEIGELCKEKNIYFHTDAVQAIGHVDIDVKDMNIDLLSMSAHKFYGPKGVGALYIKNGVKIQNLIHGGGQERGKRASTENTAGIVGLGKAIELAMENMPEENEKLSNLRGRLIRGIEARIPEVKLNGPKDMSRRLPNNVNFSFIGIEGETLLLDLDMNGIFGSTGSACASASLDPSHVLLSIGLPHETAHGSLRLSLGAKNTEEDIDYVLEVLPKIIKQRREMSPLWEDYMKNKEEK

iscS

Cysteine desulfurase IscS

397 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.108 kDa

MNKQVYMDYSATTYTKPEVLEEMLPFFTENFGNPSSLYSFSDKTKKAVNLARERVSKALNAEKNEIFFTSGGSEADNWALKGIAYANKKKGNHIITTKIEHHAILHTAQFLEKEGFKVTYLPVDEEGFVSVEDIKNAITDETILVSVMFANNEIGTIEPIKEIGELCKEKNIYFHTDAVQAIGHVDIDVKDMNIDLLSMSAHKFYGPKGVGALYIKNGVKIQNLIHGGGQERGKRASTEDTAGIVGLGKAIELAMENMPEENEKLSNLRGRLIRGIEARIPEVKLNGPKDMSRRLPNNVNFSFIGIEGETLLLDLDMNGIFGSTGSACASASLDPSHVLLSIGLPHETAHGSLRLSLGAKNTEEDIDYVLEVLPKIIKQRREMSPLWEDYMKNKEEK

iscS

Cysteine desulfurase IscS

396 amino acids

Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

43.461 kDa

MEKRFIYADNAATTAVSEEVLSAMLPYFRTAYGNASSIYKLGRDAQRDVELAREKVAKALGAEPREIYFTSCGSESDNWAIKGTAELMAKKGKKHIVTSVFEHHAVLHTCEYLEKHGYEVTYVPVNDKGLIDPEDVRKAVREDTALVTIMYANNEIGTIQPIEEIAAVCREKGVLFHTDAVQAVGHVDIDVHKQGIDMLSLSGHKIHAQKGIGAIYIRKGIVLPNLVHGGGQERGKRAGTENVPAIVGLGVAIEAAVRNTAEKAAIIIPRRNRIIDELLKIPYTRLNGDREKRLPGNINISFEGIEGESLLLMLDLNGICASSGSACTSGSLDPSHVLLSIGLKHAVAHGSLRLSIEEDVSDEDVEYIIETIPKVVQRLRSMSPVWERMMKGEKYD

iscS

Cysteine desulfurase IscS

395 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

43.126 kDa

MKLPIYLDYSATTPADPRVAAKMMQYLTQDGTFGNPASRSHRFGWQAEEAVDVARNQIAELVGADPREIVFTSGATEANNLAIKGAASFYREKGRHIVTCATEHKAVLDTCAQLEHEGFSVTYLTPQSDGSLTLRQVESALRDDTVLVTIMHVNNEIGVVQDIASIGELCRARGIIFHVDATQSVGKLPVDLGQLPVDLMSFSAHKIYGPKGIGALYVCRRPHIRLEAQIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKETMADDMTRIGALRRRLWQGINRIEAVSVNGSLEHGAANILNVCFHYVDGESLVMALKDLAVSTGSACTSASMEPSYVLRAIGLSDELAHSSIRFSLGRLTSEEEIDYAIQLLQKSITRLREHSPAWRAFKAGSE

iscS

Cysteine desulfurase IscS

394 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

44.103 kDa

MKREVYLDYAATTPLRKEVYEAMKPFLKEKFGNPSSIHHFGRETRTAIEEAREKIAKAIGAKSDEIIFTSGGTESNNMAIKGVAFALSTKGKHIITSKVEHHAVLEPCHFLEKLGFEITYLPVDREGFVDPDDLKKALRKDTILISIMHANNEIGTIEPIQELSKIAKEYDIYFHTDAVQTVGHIPVNVDELGVDLLSISAHKFYGPKGVGALYIRKGTKIHPLIHGGSQENNKRAGTENVAGIIGMGKAIELAILEMDKEIERLTELRDYFIREVEKRISDVYLNGPRSNRLPNNINFSFAYVEGESILLHLDLEGVEVSTGSACSSSSLEPSHVLSAINVPIELAHGSIRFTLGLYTTKEDLNYTLDVLERIIEKLRTISPYKQEWKINKKS

iscS

Iscs-like cysteine desulfurase

393 amino acids

Catalyzes the removal of elemental sulfur from cysteine to produce alanine.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

40.947 kDa

MAYLDHAATTPMHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIEEARELIADKLGARPSEVIFTAGGTESDNLAVKGIYWARRDAEPHRRRIVTTEVEHHAVLDSVNWLVEHEGAHVTWLPTAADGSVSATALREALQSHDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLPLDFGASGLSAMSVAGHKFGGPPGVGALLLRRDVTCVPLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVLAEIDDVCLNGADDPMRLAGNAHFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPSHVLIAMGVDAASARGSLRLSLGHTSVEADVDAALEVLPGAVARARRAALAAAGASR

iscS

IscS-like cysteine desulfurase

393 amino acids

Catalyzes the removal of elemental sulfur from cysteine to produce alanine (Probable). Participates in the biosynthesis of metalloclusters by providing the inorganic sulfur required for Fe-S core formation. One acceptor is Whib3, on which this enzyme assembles a 4Fe-4S cluster. It can use both L-cysteine and L-selenocysteine as substrates.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

40.947 kDa

MAYLDHAATTPMHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIEEARELIADKLGARPSEVIFTAGGTESDNLAVKGIYWARRDAEPHRRRIVTTEVEHHAVLDSVNWLVEHEGAHVTWLPTAADGSVSATALREALQSHDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLPLDFGASGLSAMSVAGHKFGGPPGVGALLLRRDVTCVPLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVLAEIDDVCLNGADDPMRLAGNAHFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPSHVLIAMGVDAASARGSLRLSLGHTSVEADVDAALEVLPGAVARARRAALAAAGASR

iscS

Cysteine desulfurase IscS

387 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

42.418 kDa

MLQRIYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVKEAITEKTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGPKGIGGLYIRSGVGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRVPNTTLVSVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANPVMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAIRLRNISSSY

iscS

Cysteine desulfurase IscS

387 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

42.432 kDa

MLQRIYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIITTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITADQVKEAITEKTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANVDFLSFSAHKFHGPKGIGGLYIRSGVGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRVHRVPNTTLISVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANPVMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVRLRNISSSY

iscS

Cysteine desulfurase IscS

387 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

42.478 kDa

MLQRIYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIVTTVTEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVKEAITEKTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANVDFLSFSAHKFHGPKGIGGLYIRSGVGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRVPNTTLISVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANPVMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAATRLRNISSSY

iscS

Cysteine desulfurase IscS

387 amino acids

Master enzyme that delivers sulfur to a number of partners involved in Fe-S cluster assembly, tRNA modification or cofactor biosynthesis. Catalyzes the removal of elemental sulfur atoms from cysteine to produce alanine. Functions as a sulfur delivery protein for Fe-S cluster synthesis onto IscU, an Fe-S scaffold assembly protein, as well as other S acceptor proteins.

Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. NifS/IscS subfamily.

42.404 kDa

MLQRIYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVKEAITEKTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHKFHGPKGIGGLYIRSGVGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRVPNTTLVSVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANPVMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVRLRNISSSY