hrpZ

Harpin HrpZ

370 amino acids

Harpins are proteins able to elicit hypersensitive response (HR) in non-host plants and are required for pathogenicity in host plants. HrpZ forms ion-conducting pores permeable for cations. Such pore-forming activity may allow nutrient release and/or delivery of virulence factors during bacterial colonization of host plants (By similarity).

Belongs to the harpin HrpZ family.

36.513 kDa

MQALNSISSLQTSASLFPVSLNSDVSANTSTSSKELKAVIDQLVQALTQSGQLDETSPLGKMLAKAMAADGKSANSIDDITASLDKLIHEKLGDNFGASAGIGAGGGGGGIGGAGSGSGVGGGLSSDAGAGQSDLMSQVLNGLGKAVLDDLLTPSGEGGTTFSSDDMPTLEKVAQFMDDNKAQFPTRDGGSWMNELKEDNGLDAQETAQFRSALDVIGQQLGQQQGDASGVTSGGGLGSPVSDSSLGNPAIDANTGPAANGNASVDVGQLIGQLIDRGLQSVSSGGGLGTPVDNSTQPTGGTPAANPTGNVSNQDLGQLLSGLLQRGLEATLQDAGNTGADLQSSAAQVAAQLINALLQGTNNQTNQAVA

hrpZ

Harpin HrpZ

345 amino acids

Harpins are proteins able to elicit hypersensitive response (HR) in non-host plants and are required for pathogenicity in host plants. HrpZ forms ion-conducting pores permeable for cations. Such pore-forming activity may allow nutrient release and/or delivery of virulence factors during bacterial colonization of host plants (By similarity).

Belongs to the harpin HrpZ family.

35.29 kDa

MQSLSLNSSTLQSPSMALVLIRPETETTGPSTSSRALQEVIAQLAQELTHNGQLDESSPLGKLLGKAMAASGKAGGGLEDIKAALDTLIHEKLGDNFGASADNASDTGQHDLMTQVLNGLAKSMLNDLLTKQDDGTRFSEDDMPMLKKIAEFMDDNPAQFPKPDSGSWVNELKEDNFLDGDETAQFRSALDIIGQQLGSQQNAAGGLAGDSSGGGLGSPVSNTENSPGSLGDPLIDANTGPASNSNSNGDVGQLIGELIDRGLQSVLAGGGLGTPVSTANTALVPGGEQPNQDLGQLLGGLLQKGLEATLQDAGQTGTGVQSSTAQVALLLVNMLLQSTKNQAAA

hrpZ

Harpin HrpZ

345 amino acids

Harpins are proteins able to elicit hypersensitive response (HR) in non-host plants and are required for pathogenicity in host plants. HrpZ forms ion-conducting pores permeable for cations. Such pore-forming activity may allow nutrient release and/or delivery of virulence factors during bacterial colonization of host plants. Also binds peptides, which contain tryptophan and leucine, suggesting a protein-protein interaction between the harpin and a host plant protein, possibly involved in the bacterial pathogenesis.

Belongs to the harpin HrpZ family.

35.25 kDa

MQSLSLNSSTLQSPSMALVLIRPETETTGSSTSSRALQEVIAQLAQELTHNGQLDESSPLGKLLGKAMAASGKAGGGLEDIKAALDTLIHEKLGDNFGASADNASDTGQHDLMTQVLNGLAKSMLNDLLTKQDDGTRFSEDDMPMLKKIAEFMDDNPAQFPKPDSGSWVNELKEDNFLDGDETAQFRSALDIIGQQLGSQQNAAGGLAGDSSGGGLGSPVSNTENSPGSLGDPLIDANTGPASNSNSNGDVGQLIGELIDRGLQSVLAGGGLGTPVSTANTALVPGGEQPNQDLGQLLGGLLQKGLEATLQDAGQTGTGVQSSAAQVALLLVNMLLQSTKNQAAA

hrpZ

Harpin HrpZ

342 amino acids

Harpins are proteins able to elicit hypersensitive response (HR) in non-host plants and are required for pathogenicity in host plants. HrpZ forms ion-conducting pores permeable for cations. Such pore-forming activity may allow nutrient release and/or delivery of virulence factors during bacterial colonization of host plants (By similarity).

Belongs to the harpin HrpZ family.

34.669 kDa

MQSLSLNSSSLQTPAMALVLVRPETETTGASTSSRALQEVVVKLAEELMRNGQLDDSSPLGKLLAKSMAADGKAGGGIEDVIAALDKLIHEKLGDNFGASADNASGTGQQDLMTQVLSGLAKSMLDDLLTKQDGGSSFSEDDMPMLSKIAQFMDDNPAQFPKPDSGSWVNELKEDNFLDGDKTAAFRSALDIIGQQLGNQQSDAGGLAGTGGGLGTPSSFSNNSSVTGDPLIGANTGPGDSGNSSSEAGQLIGEFIDRGLQSVLAGGGLGTPVNTPQTGTAANGGQSAQDLDQLLGGLLLKGLEATLKDAGQTATDVQSSAAQIATLLVSTLLQGTRNQAAA

hrpZ

Harpin HrpZ

341 amino acids

Harpins are proteins able to elicit hypersensitive response (HR) in non-host plants and are required for pathogenicity in host plants. HrpZ forms ion-conducting pores permeable for cations. Such pore-forming activity may allow nutrient release and/or delivery of virulence factors during bacterial colonization of host plants (By similarity).

Belongs to the harpin HrpZ family.

34.721 kDa

MQSLSLNSSSLQTPAMALVLVRPEAETTGSTSSKALQEVVVKLAEELMRNGQLDDSSPLGKLLAKSMAADGKAGGGIEDVIAALDKLIHEKLGDNFGASADSASGTGQQDLMTQVLNGLAKSMLDDLLTKQDGGTSFSEDDMPMLNKIAQFMDDNPAQFPKPDSGSWVNELKEDNFLDGDETAAFRSALDIIGQQLGNQQSDAGSLAGTGGGLGTPSSFSNNSSVMGDPLIDANTGPGDSGNTRGEAGQLIGELIDRGLQSVLAGGGLGTPVNTPQTGTSANGGQSAQDLDQLLGGLLLKGLEATLKDAGQTGTDVQSSAAQIATLLVSTLLQGTRNQAAA