homt-1

Alpha N-terminal protein methyltransferase 1

234 amino acids

Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif.

Belongs to the methyltransferase superfamily. NTM1 family.

26.632 kDa

MSSSSSSRIHNGEDVYEKAEEYWSRASQDVNGMLGGFEALHAPDISASKRFIEGLKKKNLFGYFDYALDCGAGIGRVTKHLLMPFFSKVDMEDVVEELITKSDQYIGKHPRIGDKFVEGLQTFAPPERRYDLIWIQWVSGHLVDEDLVDFFKRCAKGLKPGGCIVLKDNVTNHEKRLFDDDDHSWTRTEPELLKAFADSQLDMVSKALQTGFPKEIYPVKMYALKPQHTGFTNN

homt-1

Alpha N-terminal protein methyltransferase 1

231 amino acids

Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity).

Belongs to the methyltransferase superfamily. NTM1 family.

26.479 kDa

MSSRLHNGNDVYEKAEEYWSRASQDVNGMLGGFETLHTPDITVSKRFIEGLKKRNLFGSYDYALDCGAGIGRVTKHLLMPLFKKVDMEDLVEELIVSSEQYIGSDPRIGEKFIEGIQTFAPPERRYDLIWIQWVSGHLVDEDLVAFFKRCVKGLKPGGCIVLKDNVTNHEKRLFDDEDHSWTRTEPELMEAFNGADLDMVVKTIQTGFPKEIYPVKIFALKPRRQETSDDN