About Services Plasmids Contact

hmtA2

Gene
hmtA2
Protein
DNA-binding protein HMt-1.2
Organism
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Length
68 amino acids
Function
Binds and compacts DNA (95 to 150 base pairs) to form nucleosome-like structures that contain positive DNA supercoils.
Similarity
Belongs to the archaeal histone HMF family.
Mass
7.275 kDa
Sequence
MAELPIAPVGRIIKNAGAQRISDDAREALAKILEEKGEEIAKEAVKLAKHAGRKTVKASDIELAAKKL