About Services Plasmids Contact

hmpT

Gene
hmpT
Protein
Thiamine precursor transporter HmpT
Organism
Lactococcus lactis subsp. cremoris (strain MG1363)
Length
166 amino acids
Function
Probably a thiamine precursor-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins.
Mass
18.09 kDa
Sequence
MKLMDNKNIKKLTLLAIWTALTFVLGRLFTFPIPGSAGNILTLLDVGIYTAVFLFGKREAAIIGGFAAFLLDLTAGFSNYMFFSLIIHGGQGYLAGLTRYKWLNFLLSLLVMVGGYFIVGGLMYGWGSAIAGLWVNIVQVIVGFVLAKVLSPLIERTGILNGFRKA