About Services Plasmids Contact

hmoA

Gene
hmoA
Protein
Heme-degrading monooxygenase HmoA
Organism
Bacillus subtilis (strain 168)
Length
108 amino acids
Function
Allows bacterial pathogens to use the host heme as an iron source. Catalyzes the oxidative degradation of the heme macrocyclic porphyrin ring in the presence of a suitable electron donor such as ascorbate or NADPH--cytochrome P450 reductase, with subsequent release of free iron.
Similarity
Belongs to the antibiotic biosynthesis monooxygenase family.
Mass
12.573 kDa
Sequence
MFVQLRKMTVKEGFADKVIERFSAEGIIEKQEGLIDVTVLEKNVRRGDEEVVVMIRWESEDHWKQWEKSDAHIAGHKANKGKPKPDYLISTEVSMYHVRAVKQGTYNQ