About Services Plasmids Contact

hmeC

Gene
hmeC
Protein
Hdr-like menaquinol oxidoreductase cytochrome b-like subunit
Organism
Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18)
Length
336 amino acids
Function
Has menaquinol-oxidizing activity. The HmeC and HmeD subunits may together mediate electron transfer from menaquinol to an unidentified electron acceptor on the cytoplasmic side of the membrane.
Mass
39.268 kDa
Sequence
MSEALYIFYALPYICFAIFVIGTIYRVVDWARSAVPLKIPTTSAQQPSFKFVRRTWIDKIDSPSSKFWAFVRVLFVVFLFRDLFRNTRYYIEMGGKNVDTRWLWLFAILFHYSLLVIVIRHLRFFTNPVPDFVKTLEYLDGVLGVAIVPPLLMTGVIALVALAFLWGRRILLAKERSISIPSDHLILFFMAVILVSGLLMRYIIKADLSYVKMFALSVVTFQPPSPEVLANLHWLFLIHFTFVCITIAYIPFSKVMHFAGVWFSPTRNMPNDNRRKRHVNPWDPNPELPILVREGITVAGVTYKCKKLDWDTYYEMYKDQLDEIAEKNYTLKAEEF

Gene
hmeC
Protein
Hdr-like menaquinol oxidoreductase cytochrome b-like subunit
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
332 amino acids
Function
Has menaquinol-oxidizing activity. HmeC and HmeD subunits may together mediate electron transfer from menaquinol to an unidentified electron acceptor on the cytoplasmic side of the membrane.
Mass
38.386 kDa
Sequence
MIGVIFGVIVPYIAVAIFVIGVIYRIVNWANSAVPLKIPTTGGQQKSFPFIKRTIYDRFDSPYTWWETAGRMLLEIFFFRSLLKNTRYYLDRVSQKDARWLWLFGILFHYSLLLVLIRHSRFFLDPVPSFVETLSEIEAFKGVFIPSVYMSGLAIVAALFLLWLRRIFLSRERTLSLPSDHFALILLLAITISGNVMRYFVKADLFAVKELLMSLMTFNIGHAVEVANTIEPIFYVHFALASFLLAYFPFSKLMHAGGVFFSPTRNMPNDNRARRHVNPWDPADVPLLAKGITVAGRVYKSKKLDWDTYYSMYTDQLQEIEEADYKIVPEEL