About Services Plasmids Contact

hiuH

Gene
HIUH
Protein
Hydroxyisourate hydrolase
Organism
Glycine max
Length
560 amino acids
Function
Involved in the conversion of hydroxyisourate to ureides such as allantoin, the major form of nitrogen transport in legumes.
Similarity
Belongs to the glycosyl hydrolase 1 family.
Mass
63.767 kDa
Sequence
MMEPPQTRLMINVFIVSFLALLVNLVVGVLGADNYSRDDFPLDFVFGSGTSAYQVEGAANKDGRTPSIWDTFAYAGYAHGENGDVACDGYHKYKEDVQLMLETGLDAYRFSISWSRLLPNGRGPVNPKGLQYSNNLINELISNGIQPHATLYNFDLPQVLEDEYGGWISRDIIRDFTYYAEVEFREFGDRVLYWTTVNEPNVFALGGYDQGNSPPRRCSPPFCATNDTMGNSTYEPYLAVHHILLSHSSAARLYWRKYRDKQHGFVGISIYTFGIFPQTNTEKDRVASQRARDFFVGWIMEPLQYGDYPISMKTNAGERIPAFTNHESKQVKGSFDFIGVIHYTNLNVSDNSDALKNQLRDFTADMAANIFGEDLFSNEEYLITPWGLRQELNKFKLLYGNPPIFIHENGQRTASNSSLQDVDKGEILHGYIGSVLDALRDASNIKGYFRMAFPGFVRVARWIQVSFGLYYVDRDDPQLKKIPKLFCKNGTTGFLKGRRTSILDLFELEQDPITCSKSPIIFSKISKWVLASLLFLIQHKIKFMWREPLPGQIPLKLVMF

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Escherichia coli O157:H7
Length
137 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.537 kDa
Sequence
MLKRYLVLSVVTAAFSLPSLVYAAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Escherichia coli (strain K12)
Length
137 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.46 kDa
Sequence
MLKRYLVLSVATAAFSLPSLVNAAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Escherichia coli O157:H7
Length
137 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.537 kDa
Sequence
MLKRYLVLSVVTAAFSLPSLVYAAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Escherichia coli (strain K12)
Length
137 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.46 kDa
Sequence
MLKRYLVLSVATAAFSLPSLVNAAQQNILSVHILNQQTGKPAADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVVFKTGDYFKKQNLESFFPEIPVEFHINKVNEHYHVPLLLSQYGYSTYRGS

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Salmonella dublin
Length
136 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.105 kDa
Sequence
MKRHILATVIASLVAAPAMALAAGNNILSVHILDQQTGKPAPGVEVVLEQKKDNGWTQLNTGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYHVPLLLSQYGYSTYRGS

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Salmonella dublin
Length
136 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.105 kDa
Sequence
MKRHILATVIASLVAAPAMALAAGNNILSVHILDQQTGKPAPGVEVVLEQKKDNGWTQLNTGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYHVPLLLSQYGYSTYRGS

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Salmonella typhi
Length
136 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.076 kDa
Sequence
MKRYILATAIASLVAAPAMALAAGSNILSVHILDQQTGKPAPGVEVVLEQKKDNGWTQLNTGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYHVPLLLSQYGYSTYRGS

Gene
hiuH
Protein
5-hydroxyisourate hydrolase
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
136 amino acids
Function
Catalyzes the hydrolysis of 5-hydroxyisourate (HIU) to 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline (OHCU).
Similarity
Belongs to the transthyretin family. 5-hydroxyisourate hydrolase subfamily.
Mass
15.131 kDa
Sequence
MKRYILATVIASLVAAPAMALAAGNNILSVHILDQQTGKPAPGVEVVLEQKKDNGWTQLNTGHTDQDGRIKALWPEKAAAPGDYRVIFKTGQYFESKKLDTFFPEIPVEFHISKTNEHYHVPLLLSQYGYSTYRGS