About Services Plasmids Contact

hisS1

Gene
hisS1
Protein
Histidine--tRNA ligase 1
Organism
Bacillus cereus (strain ATCC 10987 / NRS 248)
Length
436 amino acids
Similarity
Belongs to the class-II aminoacyl-tRNA synthetase family.
Mass
49.16 kDa
Sequence
MEMKNVKGTKDYLPEEQVLRNKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRNLALRYDLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFRTLNLEVTIQYNNRKLLNGILESINIPTERTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTVLSCLKLTIADFKEAFNNPLVADGVNELQQLQQYLIALGINENAIFNPFLARGLTMYTGTVYEIFLKDGSITSSIGSGGRYDNIIGAFRGDNMNYPTVGISFGLDVIYTALSQKETISSTADVFIIPLGTELQCLQIAQQLRSTTSLKVELELAGRKLKRALNYANKENIPYVLIIGEDELSTETVVLRNMKEGSEVKVPLSSLKDNTFNNYCNIPIKL

Gene
hisS1
Protein
Histidine--tRNA ligase 1
Organism
Bacillus clausii (strain KSM-K16)
Length
426 amino acids
Similarity
Belongs to the class-II aminoacyl-tRNA synthetase family.
Mass
47.533 kDa
Sequence
MSIQLPRGTQDILPDDAAIWQYIEQVAKETCETYHYQEIRTPIFEHTEIFSRGVGDTTDIVQKEMYTFSDRGGRSLTLRPEGTAAVVRSYVNHKLYASPAQPTKLYYTGPMFRYERPQAGRMRQFVQFGVEALGSASPQLDAEVLALLIAICKKLGLVNLKLVINSLGDSESRQAHREALIAHFKPSIDEFCSDCQMRLEKNPLRILDCKKDREHPLMATAPSILDYLNEESRAYFQSLKETLDLLNIPYVVDPTLVRGLDYYNHTAFELLSTAPGFGAITTLCGGGRYNGLVQEFGGPETPGIGFAFSIERFILAMKAENVDLPVPQSLDAYVVTLGDEASRLGPQLLQRLRDGGIRADKDYLGKKMKAQLKAADRYQASYTIIIGEDEIAKQQALVKQMATGEQTVVAISDLTSFLQEQIRGGN

Gene
hisS1
Protein
Histidine--tRNA ligase 1
Organism
Bacillus cereus (strain ZK / E33L)
Length
425 amino acids
Similarity
Belongs to the class-II aminoacyl-tRNA synthetase family.
Mass
47.97 kDa
Sequence
MEMKNVKGTKDYLPEEQVLRNKIKRACEDTFERYGCKSLETPTLNMYELMSYKYGGGDEILKEIYTLRDQGKRELALRYDLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFRTLNLEVTIQYNNRKLLNGILESINIPTERTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTVLSCLKLSIDDFKDAFNTPLVAEGVNELQQLQQYLIALGINENAIFNPFLARGLTMYTGTVYEIFLKDGSITSSIGSGGRYDNIIGAFRGDNMNYPTVGISFGLDVIYTALSQKETISSTADIFIIPIGTELQCLQIAQQLRSTTSLKVELELTGRKLKRALNYANKENIPYVLIIGEEELSTETAMLRNMKEGSEVKVPLSSLSNYL

Gene
hisS1
Protein
Histidine--tRNA ligase 1
Organism
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Length
425 amino acids
Similarity
Belongs to the class-II aminoacyl-tRNA synthetase family.
Mass
47.901 kDa
Sequence
MEMRNVKGTKDYLPEEQVLRNKIKRACEDTFERYGCKPLETPTLNMYELMSYKYGGGDEILKEIYTLQDQGKRDLALRYDLTIPFAKVVAMNPNIRLPFKRYEIGKVFRDGPIKQGRFREFIQCDVDIVGVESVMAEAELMSMAFELFQTLNLEVTIQYNNRKLLNGILQAIHIPTELTSDVILSLDKIEKIGIDGVRKDVLERGISEEMADTICNTVLSCLQLSIADFEEAFNNPLVADGVNELQQLQQYLIALGINENTIFNPFLARGLTMYTGTVYEIFLKDGSITSSIGSGGRYDNIIGAFRGDNMNYPTVGISFGLDVIYTALSQKETVSSTADVFIIPLGTELQCLQIAQQLRSTTSLKIELELAGRKLKRALNYANKENIPYVLIIGEEEICTETVMLRNMKEGSEVKVPLSSLSNYL