hisH

Imidazole glycerol phosphate synthase subunit HisH

242 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

26.007 kDa

MNSSLSSRRPHVALLDYGSGNVRSAQRAVERAGAEVEVTRDPETVQRADGLLVPGVGAYSACMKQLHSVYGDRLIGQRLAGGRPVLGICVGMQILFDRGVEFAEGTGEAGAGEAAFTEGMGEWPGTVEKLDADVLPHMGWNTVEVGDGSSASALGKPAAEPTKMFAGIEETERFYFVHSYGVQEWELLTDGRTEPPLVHWASHGRSRFVAAVENGPLWATQFHPEKSGDAGLKLLQNWVDTL

hisH

Imidazole glycerol phosphate synthase subunit HisH

232 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

24.699 kDa

MSVRQTTADVVVVDYGLGNLRSVTRGLERAGANVSLSEDPAEFDAADGIVLPGVGAFSEGMDNAGPFREALVEQAEAGKPLFGICLGMQMLLTTSEEADHEGQGDAEGLDLIPGKNVRFSRDQTVPHMGWNELDVTRDHPLVEGVDSVGSKTPRADGTGGSVDGEHAYFVHSYYAVPDDESATVATTDYGTDFASIVANDAGNVFGTQFHPEKSGETGLRILRNYVDYCLDH

hisH

Imidazole glycerol phosphate synthase subunit HisH

232 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

24.699 kDa

MSVRQTTADVVVVDYGLGNLRSVTRGLERAGANVSLSEDPAEFDAADGIVLPGVGAFSEGMDNAGPFREALVEQAEAGKPLFGICLGMQMLLTTSEEADHEGQGDAEGLDLIPGKNVRFSRDQTVPHMGWNELDVTRDHPLVEGVDSVGSKTPRADGTGGSVDGEHAYFVHSYYAVPDDESATVATTDYGTDFASIVANDAGNVFGTQFHPEKSGETGLRILRNYVDYCLDH

hisH

Imidazole glycerol phosphate synthase subunit HisH

228 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.508 kDa

MSVDIAVVDYGMGNLRSVSKAIEHVAPSATVVVTSSPDVIAEAGRVVFPGQGAARDCMREIDARGLREAIATAARSKPFLGICMGMQVLFEHSEEGDTACLGILPGNVQRFPHEAMHDDRGNKLKVPHMGWNNVHQGAPHPLWSGIEDGERFYFVHSYFVQPTTPDLIAGFSHYPFPFTCAVASGNIFAVQFHPEKSQNAGLTLLGNFVTWNPGEHASACDLSGASCA

hisH

Imidazole glycerol phosphate synthase subunit HisH

228 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.508 kDa

MSVDIAVVDYGMGNLRSVSKAIEHVAPSATVVVTSSPDVIAEAGRVVFPGQGAARDCMREIDARGLREAIATAARSKPFLGICMGMQVLFEHSEEGDTACLGILPGNVQRFPHEAMHDDRGNKLKVPHMGWNNVHQGAPHPLWSGIEDGERFYFVHSYFVQPTTPDLIAGFSHYPFPFTCAVASGNIFAVQFHPEKSQNAGLTLLGNFVTWNPGEHASACDLSGASCA

hisH

Imidazole glycerol phosphate synthase subunit HisH

226 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.22 kDa

MARTPNIALVDYGVGNLHSARKGLEAMGARVTLSGQPLTLSAADGVVLPGVGSFDTAITRLNDRGLGDAIIQLVRAGQPMLGICLGLQVLFDSSEEGRLPGLGLLPGRVRRFRSEPGLTIPHVGWNQLHFDNVDCPLWRDLAAGGWVYFVHSYYVDPARAEDRAASAVHGSQHFTAAVCRDNLMAVQFHPEKSADTGLRILKNFVERAASRSAAEVAARCATRPPA

hisH

Imidazole glycerol phosphate synthase subunit HisH

226 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.22 kDa

MARTPNIALVDYGVGNLHSARKGLEAMGARVTLSGQPLTLSAADGVVLPGVGSFDTAITRLNDRGLGDAIIQLVRAGQPMLGICLGLQVLFDSSEEGRLPGLGLLPGRVRRFRSEPGLTIPHVGWNQLHFDNVDCPLWRDLAAGGWVYFVHSYYVDPARAEDRAASAVHGSQHFTAAVCRDNLMAVQFHPEKSADTGLRILKNFVERAASRSAAEVAARCATRPPA

hisH

Imidazole glycerol phosphate synthase subunit HisH

225 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.434 kDa

MTSAKNVIVDTGCANLSSVKFAVERLGFEVTITDDITIIQQAEKVIFPGVGSAKHAMKNIKAKNLEAALQGLTQPVLGFCLGMQLMTESSTEGKKSSTEGNNDDNTSHIVPCLNLIPTNVEPLKAQGNRLPHMGWNTLTQVSNHPIFKGISEGDYFYFVHSFAAPISEYTIASCEYGSTFSAAIAKDNFIGCQFHPERSSALGSKIIQNFLELDSTELNQELVNL

hisH

Imidazole glycerol phosphate synthase subunit HisH

225 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.457 kDa

MSTIAIVDYGMGNFHSVARALQHAAPDADIRICNRPEQIDAADRVVFPGQGAMPDCMRTLNESGLRAAVERAAASKPLMGVCVGEQMLFERSEEGDTPCLGIFPGEVRRFAGPQFADPVAADQAAAAPPAAARERLKVPHMGWNQVRQTRSHALWEGIPDGTHFYFVHSYYAAPSDPALTTGVTDYGVAFTCAVAAANIFAVQFHPEKSAEHGLRLYRNFVDWQP

hisH

Imidazole glycerol phosphate synthase subunit HisH

225 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.457 kDa

MSTIAIVDYGMGNFHSVARALQHAAPDADIRICNRPEQIDAADRVVFPGQGAMPDCMRTLNESGLRAAVERAAASKPLMGVCVGEQMLFERSEEGDTPCLGIFPGEVRRFAGPQFADPVAADQAAAAPPAAARERLKVPHMGWNQVRQTRSHALWEGIPDGTHFYFVHSYYAAPSDPALTTGVTDYGVAFTCAVAAANIFAVQFHPEKSAEHGLRLYRNFVDWQP

hisH

Imidazole glycerol phosphate synthase subunit HisH

225 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.399 kDa

MSTIAIVDYGMGNFHSVARALQHAAPDADIRICNRPEQIDAADRVVFPGQGAMPDCMRTLNESGLRAAVERAAASKPLMGVCVGEQMLFERSEEGGTPCLGIFPGEVRRFAGPQFADPVAADQAAAAPPAAARERLKVPHMGWNQVRQTRSHALWEGIPDGTHFYFVHSYYAAPSDPALTTGVTDYGVAFTCAVAAANIFAVQFHPEKSAEHGLRLYRNFVDWQP

hisH

Imidazole glycerol phosphate synthase subunit HisH

224 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.971 kDa

MSNPDTIIIDTGCANLSSVRYAFERIGADVEVSDDIDKIKAATRVVLPGVGTARAAMKALKDKKLIDTICSLTQPVLGVCLGMQMLTKASQERGGLSYGNSSKDCQCLGLIDTNIEQLDAKGLPLPHMGWNQISPSEHPLFAGVAEGSYVYFVHSYRAPLGDFTIAKCEYGEGFSAAIAKDNFMGVQFHPEKSAAVGATILRNFMKMNAGSFAGNHKSTQESAQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

221 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.641 kDa

MSANTDEFDVVIIDTGCANLSSVRFAFERLGANVLVTDDKASIKAAKRVVLPGVGSAGAAMASLTEKALVELIQGLTQPVLGVCLGMQMLTLLSKERGGQALDCQAHDCKCLGIIPTEIDELNSQTLKAEGLPLPHMGWNQLTFSNPSQVHPLFAGVEAGSYVYFVHSYRAPLSDYTLAQCRYGEDFSAAIGKDNFMGVQFHPEKSAAVGAQILGNFLKMQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

219 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.812 kDa

MKVVVIDSGTGNLASARRGLEIAAGRAGLDAKVIASADPLDVRNADRIVLPGQGAFADCARGIAAIEGMRGAIEEGVAAGKPFLGICVGMQLMAERGLEHEGAPGFGWIKGEIAPISCPGLRLPQMGWNGLDFTSTGCVHPLLNGLQADDHAYFVHGYALRDGDQAQILATTEYGGPVVAMVASGNRAGTQFHVEKSQEVGLRILQNFMVWTPEGTSGS

hisH

Imidazole glycerol phosphate synthase subunit HisH

219 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.812 kDa

MKVVVIDSGTGNLASARRGLEIAAGRAGLDAKVIASADPLDVRNADRIVLPGQGAFADCARGIAAIEGMRGAIEEGVAAGKPFLGICVGMQLMAERGLEHEGAPGFGWIKGEIAPISCPGLRLPQMGWNGLDFTSTGCVHPLLNGLQADDHAYFVHGYALRDGDQAQILATTEYGGPVVAMVASGNRAGTQFHVEKSQEVGLRILQNFMVWTPEGTSGS

hisH

Imidazole glycerol phosphate synthase subunit HisH

219 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.467 kDa

MMATVTVLDYGSGNVRSAVRALERAGAEVTLSAKADDVLNADGLVVPGVGAFATVMKELKSVDALRMIGRRVAGGRPVLAICVGLQILFEAGVEHGNSEPGMGEWPGTVELLPADVVPHMGWNTVQAPADSMLFDGVRDERFYFVHSYGVQHWDFDVTQPKMKPPAVTWSEHGAKFIAAVENGPLCATQFHPEKSDDAGARLLKNWVDSLPATGRNQVA

hisH

Imidazole glycerol phosphate synthase subunit HisH

218 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.959 kDa

MDTTGTGQRGASIVVVDYGLGNLRSVTRGLERASADVSIVGDPGALDDADGIVLPGVGAFGDGMENAGPFRDALTDAADEGRPLFGICLGMQMLLSSSEEADHEGQGDARGLDLIPGRNVRFTGTVKVPHMGWNELAVTRDHPLVGGVDGEYAYFVHSYYAAPDDPGHVVAETDYGERFPAVVANDAGNVFGTQFHPEKSGATGLRILRNFVDYCADQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

218 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.959 kDa

MDTTGTGQRGASIVVVDYGLGNLRSVTRGLERASADVSIVGDPGALDDADGIVLPGVGAFGDGMENAGPFRDALTDAADEGRPLFGICLGMQMLLSSSEEADHEGQGDARGLDLIPGRNVRFTGTVKVPHMGWNELAVTRDHPLVGGVDGEYAYFVHSYYAAPDDPGHVVAETDYGERFPAVVANDAGNVFGTQFHPEKSGATGLRILRNFVDYCADQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

218 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.661 kDa

MTTIIDYGIGNLRSIEKAFETVGATVHRTDDPAAIAEAERLVLPGVGAFRACIDEIRRRDLEGPIHDAIGRGVPFLGVCVGMQLLFETGYEKGEHEGLGVLPGHVAHFRETDAGMPDELTVPHMGWNAIEPTRDHPLLDELGATPYVYFVHSYHPVAEDADDVLTTTSYGHTFPSVVQRDNVFGVQFHPEKSQAAGLGLLDNFAALPTTEEAGRTVST

hisH

Imidazole glycerol phosphate synthase subunit HisH

218 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.266 kDa

MNQADNSTVIIDTGCANLSSVRYAFERICSDVIVSDNHDLIKAATRVVLPGVGTAGAAMASLKDKSLVGLIQGLTQPVLGVCLGMQMMTQVSKEHGGRDIDCECLGLIPTDVEELNSQGQPLPHMGWNQISPSMHPLFAGIPAGSYLYFVHSYRVPLSDYTIASCEYGETFSAAIAKDNFMGVQFHPEKSAAIGSKILSNFLALDKASLDAALQEPKS

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.457 kDa

MLAILDYKAGNQTSVRRALEHLGVPCAITADPAMLESAAGVIFPGVGAAGQAMSALAEAGLDKALHHVARRGQPLLGICLGCQILLESSEENAAKTLGIVPGVCRRFEDHMRQEDGSAAPVPHMGWNSLEAVAPCVLLDGIDPASEYYFVHSYYVEPDPSLVLATTTYGRTFCSLYGRDGLWAAQFHPEKSGRPGLRLLGNFYEYCRQSRQEARHAQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.227 kDa

MSKLRVGIINYGVGNLGSVQNAFAFIQTHFSDVLPHTLEIKVESHPERLQDYDKLLLPGVGAFGNAMTHLKNTHLDEAIREFVQSGKFLIGICLGMQLLFEQSEEFGNHKGLGLIEGKVVGFEHIAPLKVPHIGWNSCNFTPEGKHSKLFRGIADGSFFYFVHSFHIQTQPQFILAQCTYGYPFGAIVHKDNLFAIQAHPEKSHNVGLRLLANFLTL

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.194 kDa

MASTPQIAVVDYDMGNLHSACKGLEAAGANPIVTADPATILAADGVLLPGVGAFDPAMDHLRDRQLIEPLHQAATSGKPFLGICLGLQLLFEASEEGQSAGLGILPGRVQRFRSEPGLVIPHMGWNQLQLQQPDCPLWQNLGADPWFYFVHTYYVVPSEPTLTAATVQHGSQPVTAAIARDRLWAVQFHPEKSAKAGLQLLANFVTQVAAAQLQTVA

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

24.227 kDa

MSKLRVGIINYGVGNLGSVQNAFAFIQTHFSDVLPHTLEIKVESHPERLQDYDKLLLPGVGAFGNAMTHLKNTHLDEAIREFVQSGKFLIGICLGMQLLFEQSEEFGNHKGLGLIEGKVVGFEHIAPLKVPHIGWNSCNFTPEGKHSKLFRGIADGSFFYFVHSFHIQTQPQFILAQCTYGYPFGAIVHKDNLFAIQAHPEKSHNVGLRLLANFLTL

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.194 kDa

MASTPQIAVVDYDMGNLHSACKGLEAAGANPIVTADPATILAADGVLLPGVGAFDPAMDHLRDRQLIEPLHQAATSGKPFLGICLGLQLLFEASEEGQSAGLGILPGRVQRFRSEPGLVIPHMGWNQLQLQQPDCPLWQNLGADPWFYFVHTYYVVPSEPTLTAATVQHGSQPVTAAIARDRLWAVQFHPEKSAKAGLQLLANFVTQVAAAQLQTVA

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.661 kDa

MTTIAIVDYGVGNLRSVAQALRAAAPEADVRVVDAPEGIRSADRVVLPGQGAMPDCMSALGASGLQEAVIEAAASKPMFGVCVGEQMLFESSSEARPGTDKTPCLGLMPGEVIRFELDGMTQPDGSRYKVPQMGWNRVKQSRPHPLWDGIPDESWFYFVHSYFVRAQDPAHIAGETEYGVVFTSAVARDNIFATQFHPEKSAAMGLQLYRNFVHWNP

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.85 kDa

MTTIAIVDYGMGNLRSVAQALSTVAPDADVRISAQADEIRAADRVVLPGQGAMPDCMAAFDQSGLREAVLEAARTKPMLGVCVGEQMLLERSAEARAGEAFTAGLGLISGDVIRFDLDGRLQPDGSRYKVPQMGWNRVHQSRTHALWAGVPDQSYFYFVHSYYARPAHPDESVGETEYGVRFTCAIARDNIFATQFHPEKSAQAGLQIYRNFVHWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

217 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.496 kDa

MSSVAVIDYGMGNLHSIAKALQHADANAAVTVTSDPDVILASDRVVFPGVGAMRDCMAHLAERRLEQVVRRAAAEKPFLGICLGMQALLEESEENGGTRCLGLITGRVLRFPEGLTGAAGEPLKIPHMGWNRVHFSDPSHPLWAGIPAESWFYFVHSYYAAPADPADVAATSDYPTPFAAAVARGKVFAVQFHPEKSQAAGLRLLANFLRWEPWSSR

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.63 kDa

MSVAIVDYGSGNLHSAAKAFERAARSMENPEPILVTRDPDQVFRADRVVLPGVGAFADCRKGLDSIDGMVQALNETVRDKARPFFGICVGMQLMATRGKEHVTTDGLNWIAGDVVKIAPDREDLKIPHMGWNTLDPVREHPVLEKLPLGPKGLHAYFVHSFHLAAEHEGDVLARADYGGPVTAVVGKDTAIGTQFHPEKSQRFGLALISNFLKWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.571 kDa

MSIAIIDYGSGNLHSAAKAFERAARSLEDPQKVFVTSDPDQAYGADRLVLPGVGAFADCRRGLDAVNGMVEAITEAVRVKARPMFGICVGMQLFATRGKEHVITQGLNWIGGDVEKITPRDESLKIPHMGWNTLDVLREHPVLNKLPLGPKGQHAYFVHSYHLNAANEADVLARADYGGPVTAIVAKDTAIGTQFHPEKSQRFGLALISNFLRWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.232 kDa

MRVAIIDYGSGNLRSATKAFERAAHESGISAEIDLTCDAQRVASADRIVLPGVGAYADCRRGLDAAPGMVEALNDTVLKKARPFLGICVGMQLMSERGLEKTVTNGLGWIAGDVREMVPSDASLKIPQIGWNRIHVKHSHPIFDGIPTGDDGLHAYFVHSYMLDAKNASDVLAVTDYGGDVTAAVGRDNMVGTQFHPEKSQLLGLSLIANFLKWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.232 kDa

MRVAIIDYGSGNLRSATKAFERAAHESGISAEIDLTCDAQRVASADRIVLPGVGAYADCRRGLDAAPGMVEALNDTVLKKARPFLGICVGMQLMSERGLEKTVTNGLGWIAGDVREMVPSDASLKIPQIGWNRIHVKHSHPIFDGIPTGDDGLHAYFVHSYMLDAKNASDVLAVTDYGGDVTAAVGRDNMVGTQFHPEKSQLLGLSLIANFLKWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.294 kDa

MRVAIIDYGSGNLRSATKAFERAAHESGISAEIDLTCDAQRVASADRIVLPGVGAYADCRRGLDAVPGMVEALNDTVLKKARPFLGICVGMQLMSERGLEKTVTNGLGWIAGDVREMVPSDASLKIPQIGWNRIHVKHSHPIFDGIPTGDDGLHAYFVHSYMLDAKNASDVLAVTDYGGDVTAAVGRDNMVGTQFHPEKSQLLGLSFIANFLKWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.23 kDa

MRVAIIDYGSGNLRSATKAFERAAHESGISAEIDLTCDAQRVASADRIVLPGVGAYADCRRGLDAVPGMVEALNDTVLKKARPFLGICVGMQLMSERGLEKTVTNGLGWIAGDVREMVPSDASLKIPQIGWNRIHVKHSHPIFDGIPAGDDGLHAYFVHSYMLDAKNASDVLAVTDYGGDVTAAVGRDNMVGTQFHPEKSQLLGLSLIANFLKWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.331 kDa

MRVAIIDYGSGNLRSATKAFERAAREGGISAEIDLTADADRVRTADRIVLPGVGAYADCAAGLRAVDGMWEAVEDVAIAQSRPFLGICVGMQLMSERGLEKTVTHGFGWISGDVKEITPTDPALKIPQIGWNTIELRRQHPLFAGIPTGPEGLHAYFVHSYHLDAKKPDEILAVADYGGPVTAAVARDNLVGTQFHPEKSQALGLALITNFLRWRP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.281 kDa

MRVAIIDYGSGNLRSATKAFERAAREAGIAAEIDLTDRPERVATADRIVLPGVGAYADCRRGLAVVEGMEEALTEAVEKTGRPFFGICVGMQLMSSRGLEKTVTKGFGWIAGDVVGMTPEDPSLKIPQIGWNTLDLKRPHPLFDGIPTGENGLHAYFVHSYHLAAERAEDVVAEAGYGGPVTAFVARDNKAGSQFHPEKSQALGLALISNFLRWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

216 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.138 kDa

MRVAIIDYGSGNLRSATKAFERAAREAGIDATIDLTDKPDHVASADRIVLPGVGAYADCSAGLNAMPGMHEALIEAVEKKAHPFLGICVGMQLMSSRGLEKTVSTGLGWIEGDVVEMTPSDPTLKIPQIGWNTLEIRHAHPLFDGIKTGADGLHAYFVHSYHLAAKHSTDVIATTNYGGAMTAFVGRDNMAGAQFHPEKSQTLGLALISNFLRWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

215 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.611 kDa

MSTTPVRAAPEVLLLDYGAGNVRSAARALERAGMTVRVTDNAADVPHAPALVVPGQGHFRQVMEAFEHGGFHGPVLDAARAGVPLLGICVGMQLLFDGSEEAPGVPGLGLIAGQVRKFAPAPERKVPQMGWNALEARGDSPLLRGLGPDAYAYFVHSYYVPVDVPVTDGAVTDYGVPFWSALSRGNLHAAQFHPEKSGAVGLALLANFRRELAPA

hisH

Imidazole glycerol phosphate synthase subunit hisH

215 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.795 kDa

MINSKNNSPIEISIIDYQMGNLYSVCKGIERSGGIPKIINSAEEIKKATALILPGVGSFDPAMKQLKKQDLINPIKDAISEKKPFLGICLGLHLLFEESEEGIESGLGILSGSVKRIKNEPEITIPHMGWNQLQLTNPKCYLWDGLTKYPWVYFVHSYFAQPKNPNVIAAAVTHGTQQVTAAIQYENISAVQFHPEKSASIGLHMLNNFVQQSCN

hisH

Imidazole glycerol phosphate synthase subunit HisH

215 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.42 kDa

MTLAGQTIAVIDYGMGNLRSVSKALEHVAGGKQVIVTADPAVVAAAERVVFPGQGAMPDCMRELDARGLRTAVLAAAKDKPFLGICVGEQMLFEHSDEGNVPALGVFAGNVKRFPDEKMHLPTGERLKVPHMGWNEVRQKPHALWSGIADGSRFYFVHSYFVEPADLALVTGICEYGVPFTCAVGRDNIFAVQFHPEKSARDGLQLLKNFVEWQP

hisH

Imidazole glycerol phosphate synthase subunit HisH

215 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.225 kDa

MTTAVVFDYGFGNVRSMVRALANLGVDTTLTSDYRQSLEADGLVVPGVGAFAACMEGLKKVDGDRVIYDRIRAGRPVLGVCVGEQIMFEHGLEHGAHAAGIGLIGGSVNLLDADVVPHMGWDTIETAPDSVLLNGVENERFYFVHSYAAMEVKPADTSRFDIDLSDSPERVSWCSYGRSRFVAAYEHGPLSATQFHPEKSGDAGSQLLKNWIATL

hisH

Imidazole glycerol phosphate synthase subunit HisH

215 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.978 kDa

MDTTDRTAEVVLVDYGLGNLRSVTRGLERAGAEVTLSADPDDFSAADGIVLPGVGAFSEGMENAGPFREALVAAAADGQPLFGICLGMQMLLTSSEEAETVGQGDVRGLDLVPGRNVRFDEGQKVPHMGWNELNVARDHPIVEGIDGEYAYFVHSYYAAPDDDAAVVATTDYSVEFPAIVANEAGNVFGTQFHPEKSGETGLQILQNFVDYCLER

hisH

Imidazole glycerol phosphate synthase subunit HisH

214 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.098 kDa

MSTIAVIDYDMGNLHSVCKGLEKAGATPKITDSSIEIDKADAVILPGVGSFDPAVQHLRTRNLEIPIKQVIASGKPFLGICLGLQILFESSEEGQEPGLGIFAGKVCRFKSEPGLTIPQMGWNKLQFTQPEHLLWSEIGSQPWVYFVHSYYVDPTDSQVTAATVTHGHQTVTAAVGKDNLIAVQFHPEKSSTAGLKILSNFVSKVIPKNLALAS

hisH

Imidazole glycerol phosphate synthase subunit HisH

214 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.098 kDa

MSTIAVIDYDMGNLHSVCKGLEKAGATPKITDSSIEIDKADAVILPGVGSFDPAVQHLRTRNLEIPIKQVIASGKPFLGICLGLQILFESSEEGQEPGLGIFAGKVCRFKSEPGLTIPQMGWNKLQFTQPEHLLWSEIGSQPWVYFVHSYYVDPTDSQVTAATVTHGHQTVTAAVGKDNLIAVQFHPEKSSTAGLKILSNFVSKVIPKNLALAS

hisH

Imidazole glycerol phosphate synthase subunit hisH

214 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

24.305 kDa

MKNIGIINCGMGNLHSVSNAISNIGFNPVIINASKDLVSFACSALVLPGVGSFDLAIDRLEKKNLIEPVKLWIQEDRPFVGICLGLQLLFEGSDEGSKPGLKIFNGYVSQFKHSLVKKVPHMGWNKLYFNRFNTIDNLVPHYFHYDLQPWAYFVHSYYIEPKDCYTFNTTSLTFYGKQKIVSSISYNNILATQFHPEKSGLFGLFILKRFLSSY

hisH

Imidazole glycerol phosphate synthase subunit HisH

214 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.603 kDa

MLGIIDYGMGNLHSVSKALERLSWSYIVSEQPEELQKADGLILPGVGSFHDAMSILNETGLTAFIKDWVDEGKPLLGICLGMQLLFEESEENKRTKGLSLLPGRVIRFPGVATDGSTYKVPHMGWNQLTFRKPNHPLLTDVEEGHVYFVHSYVVKTDADDVLLATSHYYETVPAVVGRGNILGTQFHPEKSSNVGMSILRNYGAMVEKGVKARG

hisH

Imidazole glycerol phosphate synthase subunit HisH

214 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.686 kDa

MRVALIDYGSGNLRSAAKALERAARDGGVAAEIVVTRDVEGVLGADRVVLPGVGAFANCRRGLQGIDGMVEALAEVALVRARPFLGICVGMQLLADEGVEYGRHPGLGWIGGTVEAISPADPALKIPHMGWNSLDFQADSHALLAGIEPGTHVYFVHSYHFRPADPATRLASVEYGGPLTAMIGRENLVGTQFHPEKSQAAGLRLIANFLRWAP

hisH

Imidazole glycerol phosphate synthase subunit HisH

214 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.326 kDa

MSRATKIALLDYGMGNLHSASKALSAVGAEVSITNDPKVVAAADKIFFPGVGAMRDCIAGMHEAGIDDVIRQAIFNKPVMAICVGMQALFEQSAENGGTPCLSILDGTVPAFNPEWKDEKGVQIKVPHMGWNTISGMNFEHPLWNGIEDKAHFYFVHSYYCEPADSSQVAAICDYGQPFCASILQDNLFATQFHPEKSHTAGLQLLKNFVDWDI

hisH

Imidazole glycerol phosphate synthase subunit HisH

214 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.195 kDa

MPIIAVIDYDMGNLHSACKGLQEAGTQTIVSDRPEDLVSADAVVLPGVGAFDPAMQHLRSRQLIPVIQDILASGKPFLGICLGLQILFEGSEEGTEAGLGIIPGTVKRFQSEPGITIPHMGWNQLEYQQPDLPLWRHSPAQPWVYFVHSYYVDPVDPTVKAATVTHGTQTITAAIARDNLMAVQFHPEKSSTFGLQILANFVEQVQATLATPAV

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.977 kDa

MLAILKYKAGNQTSVRRALNHIGIPNVITADPAEIAASEGIIFPGVGAAGQAMDELTAAGLDAVLKEQVEAGKPLLGICVGCQIMLDYSQENDTRTLGIIPGECHLFNPALEDETGAPIRVPHMGWNRVIPRKPCALFKGISDDAEFYFVHSYFPNPQPDYVIATTTYGKEFCSVHGGPGLWAVQFHPEKSGRPGLKLLSNFHAYCKEAANAQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.259 kDa

MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTGLDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIRVPHMGWNHIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGAEFCAIHGGPGLWAVQFHPEKSGRPGLRLLANFHRYCTEAADAQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.308 kDa

MLAILDYKAGNQTSVRRALDHLGIPCVITADPEVIQGAAGVIFPGVGAAGQAMNELVTTGLDEVLRRQVQAGRPLLGICVGCQIMLDYSQENDTKALGIIPGECRLFNPAWTDEDGAPIRVPHMGWNRIVQRRPCELLKGIEPEAEFYFVHSYYPAPPEEYVIATCTYGTEFCAIHGGPGLWAVQFHPEKSGRPGLRLLANFHRYCTEAADAQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.302 kDa

MTMIGVIDYGMGNLYSVSKALERLGCPYIVSGDKEELARVRGLILPGVGSFRDAMHILRETGLADFIRSAVQDGTPLLGICLGMQLLFDESEENGPTEGLGLLRGRVVRFPGVTNDGEPYKVPHMGWNRLRFHRSSPLLDGVEEGHVYFVHSYYVVPGEEEVVLASSEYDVDVPAVVGRDNVFGTQFHPEKSGAVGMSILNRYVGIVTGRENG

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.666 kDa

MTDQKLVTVIDYGMGNLRSVAKAAEHAADSNTRICISDKAEDIRSADAIIFPGQGAAKACMKALNETNITHALIQAATEKPFLGICMGLQVLMTHSQENEGVDCLDILKGDVQKFDLSGHPELKMPHMGWNQIHQTIDHPLWHNIEQNSRFYFVHSYFVSPHDKQIIAGETTHGKRFTSAIAQNNLFAIQAHPEKSADAGLQLFKNFLNWNGQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.31 kDa

MSSVSIVDYGVGNLLSVARAFQYFDASVNLVSTPEEIMSADRLVLPGVGAFEDGMKGLTTLNFIEPIKQFARSGKPFLGICLGMQMMLSRSTEFGQHEGLDLIAGEVVSVPSHGVDGQLHKIPHIGWNELVSTSEGEDWCHTILKNIPLNSSVYFVHSFMAMPSNPKKRLADTLYDGQAISAVIKDENMYGCQFHPEKSGEVGLSIIQQFLQI

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.021 kDa

MGLNLGVIDYGMGNLHSVGKALERLGEQAVLVQGPEDLKSVDALILPGVGSFDPAIENLRATGLIPHLKDWGNNNRPLLGICLGLQLLFERSDEGSKDGLGLFQGAVERLQSHPNERIPHMGWAPLTVERNCPLLHSDDPTPWVYFVHSYAAVPLNSSVLAATAAYGNAAVTAMVWSGRIGACQFHPEKSSAAGEAMLKRWLHWLHQGAEPVH

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.167 kDa

MSLNLGLIDYGMGNLHSVEKCLERLDQGCSLINNSDDLEGIDALILPGVGAFDPAMANLRATGLVPHLLRWGQEDRPLLGICLGLQLLFEQSDEGSDPGLGLLGGRVTRLPSKSGERIPHMGWAPLKHHGTCPLLSSDASSEWVYFVHSYAAVPTDRNDLKASAPFGDQEVTAVVWRGRVGACQFHPEKSSDAGEQMLKRWLTWLRNGAEPCP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.302 kDa

MTMIGVIDYGMGNLYSVSKALERLGCPYIVSGDKEELARVRGLILPGVGSFRDAMHILRETGLADFIRSAVQDGTPLLGICLGMQLLFDESEENGPTEGLGLLRGRVVRFPGVTNDGEPYKVPHMGWNRLRFHRSSPLLDGVEEGHVYFVHSYYVVPGEEEVVLASSEYDVDVPAVVGRDNVFGTQFHPEKSGAVGMSILNRYVGIVTGRENG

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.666 kDa

MTDQKLVTVIDYGMGNLRSVAKAAEHAADSNTRICISDKAEDIRSADAIIFPGQGAAKACMKALNETNITHALIQAATEKPFLGICMGLQVLMTHSQENEGVDCLDILKGDVQKFDLSGHPELKMPHMGWNQIHQTIDHPLWHNIEQNSRFYFVHSYFVSPHDKQIIAGETTHGKRFTSAIAQNNLFAIQAHPEKSADAGLQLFKNFLNWNGQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.31 kDa

MSSVSIVDYGVGNLLSVARAFQYFDASVNLVSTPEEIMSADRLVLPGVGAFEDGMKGLTTLNFIEPIKQFARSGKPFLGICLGMQMMLSRSTEFGQHEGLDLIAGEVVSVPSHGVDGQLHKIPHIGWNELVSTSEGEDWCHTILKNIPLNSSVYFVHSFMAMPSNPKKRLADTLYDGQAISAVIKDENMYGCQFHPEKSGEVGLSIIQQFLQI

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.021 kDa

MGLNLGVIDYGMGNLHSVGKALERLGEQAVLVQGPEDLKSVDALILPGVGSFDPAIENLRATGLIPHLKDWGNNNRPLLGICLGLQLLFERSDEGSKDGLGLFQGAVERLQSHPNERIPHMGWAPLTVERNCPLLHSDDPTPWVYFVHSYAAVPLNSSVLAATAAYGNAAVTAMVWSGRIGACQFHPEKSSAAGEAMLKRWLHWLHQGAEPVH

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.167 kDa

MSLNLGLIDYGMGNLHSVEKCLERLDQGCSLINNSDDLEGIDALILPGVGAFDPAMANLRATGLVPHLLRWGQEDRPLLGICLGLQLLFEQSDEGSDPGLGLLGGRVTRLPSKSGERIPHMGWAPLKHHGTCPLLSSDASSEWVYFVHSYAAVPTDRNDLKASAPFGDQEVTAVVWRGRVGACQFHPEKSSDAGEQMLKRWLTWLRNGAEPCP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.882 kDa

MKNQASSTVALIDYGAGNLRSVANALLASGLARENLVVTANPDEVLQADRVVLPGVGAFASCMQALKAIPDMVPALEKAVLEKGRPFLGICVGMQLLADQGEEYGVHQGLGWIKGKVTPLRPNDPSCKVPHMGWNQIGLTTDSHPLLRAGEAYFLHSYAFVPEDESTLLATTEHGGLVTAAVGRDNIMGVQFHPEKSQSYGLEFLSRFLDWNP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.35 kDa

MKTSIAIVDYGMGNLRSVAQALKKAEPAADVAIVDTPAAIRAADRVVLPGQGAMPDCMRSLGESGLQEAVIEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLLPGKVVRFELDGRLQDDGSRFKVPQMGWNRVRQSQPHPLWDGVPDDAYFYFVHSYYVTPDNPAHTVGETAYGAPFTSAVARDNLFATQFHPEKSAEVGLRLYRNFVHWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.359 kDa

MKTSIAIVDYGMGNLRSVAQALKKAEPAADVAIVDTPAAIRAADRVVLPGQGAMPDCMRCLGESGLQEAVVEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLLPGKVVRFELDGRLQDDGSRFKVPQMGWNRVRQSRAHALWDGVPDDAYFYFVHSYYVMPDDPAHTVGETAYGAPFTSAVARDNIFATQFHPEKSAEVGLRLYRNFVHWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.513 kDa

MKTSIAIVDYGMGNLRSVAQALMKAEPAADVKIVDRPEAIRAADRVVLPGQGAMPDCMRCLGESGLQEAVVEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLLPGKVVRFALEGRLQDDGSRFKVPQMGWNRVRQTQAHPLWDGVPDDAYFYFVHSYYVVPDNPAHTAGETLYGDVFTSAVARDNLFATQFHPEKSAEVGLRLYRNFVHWNP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.513 kDa

MKTSIAIVDYGMGNLRSVAQALMKAEPAADVKIVDRPEAIRAADRVVLPGQGAMPDCMRCLGESGLQEAVVEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLLPGKVVRFALEGRLQDDGSRFKVPQMGWNRVRQTQAHPLWDGVPDDAYFYFVHSYYVVPDNPAHTAGETLYGDVFTSAVARDNLFATQFHPEKSAEVGLRLYRNFVHWNP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.513 kDa

MKTSIAIVDYGMGNLRSVAQALMKAEPAADVKIVDRPEAIRAADRVVLPGQGAMPDCMRCLGESGLQEAVVEASRTKPLLGVCVGEQMLFDWSAEGDTKGLGLLPGKVVRFALEGRLQDDGSRFKVPQMGWNRVRQTQAHPLWDGVPDDAYFYFVHSYYVVPDNPAHTAGETLYGDVFTSAVARDNLFATQFHPEKSAEVGLRLYRNFVHWNP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.581 kDa

MQTVALIDYGSGNLRSAEKALREAARRRALDADIVVTADPDLVAKADRVFLPGVGAFASCRAGLDATGVYEAMNQAVHGRGVPFMGICVGHQLLATEGLEFGVTPGLNWIQGQVKKLEPNDPTLTIPHMGWNAISLVRPHALFAGIDDGAHMYFANSFALTPSHVEDVVATADHGGPFTAAVAKDNVAGVQFHPEKSQASGLALLANFLEWRP

hisH

Imidazole glycerol phosphate synthase subunit HisH

213 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.795 kDa

MILNIGLIDYGMGNLHSVEQSFKRLNQSLKIISGPNDLSNCDALILPGVGSFDPAMKNLQQTNLIPELKKWVLNNKPLLGICLGLQLLFESSDEGKSKGLGLLKGTIKHLPKSEKQLIPHMGWAELNQDKECPLFKSNSSPQWMYFVHSYSAIPSDKNDIASSVNFGDEKITAVVWKKKLAACQFHPEKSGRSGELLLSNWLAWLKKETKDLY

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.713 kDa

MLAILDYKAGNQTSVQRALNKLGIPNQITSDKEVLSKATGIIFPGVGAAGQAMDELTSGGLDELLKDLVQQKKPLLGICVGCQILLDYSEENDTQALSVIPGECRLFNPSWEDYEGVPIRVPHMGWNQIELKQDCILFKDIDPEAHFYFVHSYYPAPEEKYIIGETIYGRPFCSLHGREGLWAVQFHPEKSGRPGLKLLSNFYEYCKEVSDA

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.964 kDa

MLAILDYKAGNQTSVRRALDHLGIPCVITADPAVIAGAHGVIFPGVGAAGQAMNELLTTGLDKVLKDQVQAGKPLLGICVGCQIMLDYSQENDTKALGIVPGECRLFNAAWTEEDGTPIRVPHMGWNSIVQKRPCELLKGIEPEAEFYFVHSYYPAPPESYVIATCTYGEEFCAIHGGPGLWAVQFHPEKSGRPGLALLRNFYAYCKEASRA

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.578 kDa

MRVVVIDYNGGNLASAAQAARKAATRKGIEADVVISRDATDILNADRLILPGQGAFADCAQGLGPALRNMLETATANGTPFLGICVGMQLMCEYGLEHGRTEGLGWISGNIRRMDEAANASLRLPHMGWNTLDFTPGAHLLTDGLIPGNHGYFVHSYALHDGADSDLVATAQYGTQVPAIVARGNRCGTQFHVEKSQDVGLTILGNFLRWTS

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.578 kDa

MRVVVIDYNGGNLASAAQAARKAATRKGIEADVVISRDATDILNADRLILPGQGAFADCAQGLGPALRNMLETATANGTPFLGICVGMQLMCEYGLEHGRTEGLGWISGNIRRMDEAANASLRLPHMGWNTLDFTPGAHLLTDGLIPGNHGYFVHSYALHDGADSDLVATAQYGTQVPAIVARGNRCGTQFHVEKSQDVGLTILGNFLRWTS

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.775 kDa

MIAVINYGAGNLPNVVRALQRVGATLTVTDNPEVIRSAQAVVLPGVGATADTMASLRHLGIAEVLPAVIAASTPFLGICVGMQVLLSESEEFGLHSCLDIIPGTVRRLPEHAGKIPQIGWNQLQISPTFRNHPLFADIPDGADVYFVHSYYCAVADEAIIAARTDYGIPFPSVIIRDHLAAVQFHPEKSGDYGLRLLANFVRWSEAVQPKGV

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.359 kDa

MKVAVIDYGMGNLHSVLKSLQAVNENGADIFLTRDPEAVVKADKVVFPGQGAMPDCMRELNRHGLAEAVRETTQSKPFFGICVGAQLLFEHSEEGDTAGLGLFPGKVVRFADDQVAGGERLKVPHMGWNQVYQTRSHPLFAGIADGERFYFVHSYHFAPADAALTLAESDYPQRFACIVGRGNIFATQFHTEKSHRAGLQMMKNFLAWDGNV

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.308 kDa

MIGVIDYGMGNLYSVSKALERIDAPYFVSEHPDELKRADSYILPGVGAFRDAMEILTENGLKTFIQAAANEGKPLLGICLGMQLLFEESEEHGASEGLGLLKGKVVKLKDCDQAGNRLKVPHMGWNLLKVHRDSPLLPKAKEGFAYFVHSYYVSGIEEEALLASAEYGVCVPAVVGLGNVYGAQFHPEKSSTVGMLILERFKQFTQEQKVKK

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.397 kDa

MIGVIDYGMGNLFSVSKALERAGARYIVSADVEELKKADAYILPGVGSFRDAMQLLKQTGLEGFIYQVVQEGKLLFGICLGMQLLFEESEEAGRTKGLGLLKGRVVLLKDHDKDGQKLKVPHMGWNELTFHQPSPLFDGVPEGFAYFVHSYYVRDMNPEEQLASADYGVQVPAIVGKGNVLGAQFHPEKSSTTGMALLKQFIQLANEQRVNK

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.303 kDa

MIGVIDYGMGNLYSVSKALERVGVPYFVSEKPEELKEADAFILPGVGSFGDAMDNLGYTKLDQLIHDMVSEGRLLLGICLGMQLLFEESEENGTASGLGLLKGKAVRLKAEDEKGNKLKVPHMGWNRLSFHNESPLLTKTEQGYAYFVHSYYIDGMEENALLASADYGVRVPAVVGKRNVFGAQFHPEKSSTVGMSILTQFTKMAAEQKVKK

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.259 kDa

MIGVIDYGMGNLFSVSKALERVGVPYVVSDRPEELEKADAFILPGVGSFSDAMDNLRRAKLDQFIHRMVDEGKLLLGICLGMQLIFEESTENGSAKGLGLLAGKAVRLKDRDAEGNKLKVPHMGWNRLTFHQTSPLLSEAEEGFVYFVHSYYIDGMEDGDLLASAEYGVRVPAVVGKRNVFGAQFHPEKSGTAGMAILTQFTKMAAEQQVKK

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.207 kDa

MLTVLVDYDSGNLHSAEKAFQRMATETGAGQVLVSDRPEDVARADRIVLPGDGAFPACRRALGSYGGLSEAIEEAVTRRARPFLGICIGMQMMATRGLEHEETPGFGWIAGEVVRIAPSDPHLKVPHMGWNDLTVDHPHPVLTGIETGDHAYFVHSYHFQVAHDAERLAHADYGADITAIVGRDTMVGTQFHPEKSQKTGLRLIANFLTWKP

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.923 kDa

MLTAIIDYESGNLHSAEKAFQRMARETGAGEVVVTSDADLVARADRLVLPGDGAFPACAAELRGHKGLYDAMVEAVEQKGRPFLGICVGMQLMATTGHEYEETPGLGWVAGDVVRITPENAALKVPHMGWNDLVIEAAHPIFDGIAGGDHVYFVHSYHFRVTNPTERLAHVDYGGPVTAVVGRDTMVGLQFHPEKSQAIGLRMIGNFLTWTP

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.775 kDa

MIAVINYGAGNLPNVVRALQRVGATLTVTDNPEVIRSAQAVVLPGVGATADTMASLRHLGIAEVLPAVIAASTPFLGICVGMQVLLSESEEFGLHSCLDIIPGTVRRLPEHAGKIPQIGWNQLQISPTFRNHPLFADIPDGADVYFVHSYYCAVADEAIIAARTDYGIPFPSVIIRDHLAAVQFHPEKSGDYGLRLLANFVRWSEAVQPKGV

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.676 kDa

MNTNIGIIDYGMGNLHSVQQSFKRLDQSIRIVKSPNDVHECNALILPGVGSFDPAMENLRRTDLIPKIKSWVKDGKPLLGICLGLQLIFESSEEGNSEGLGLLKGKVCNLPRNTKERIPHMGWSLLKQIKECPLLDNENTSRWMYFVHSYSAIPSPEDLAATVSFGDSEVTAIVWKDSLGACQFHPEKSGKSGQRLLSSWLKWLHEKNSDLS

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.572 kDa

MQTVAVIDYGMGNLHSVAKALEHVGAGRVLITSDAKVIREADRVVFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLDRSEESGGVDCIGLFPGQVKFFGKDLYEEGEHLKVPHMGWNQVAQAVDHPLWHDIPDLARFYFVHSFYIDAANQRQVVGRGHYGLDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.367 kDa

MQTVAVIDYGMGNLHSVAKALEHVGAGKVLITSDASVIREADRVVFPGVGAIRDCMAEIRRLGFDALVREVSQDRPFLGICVGMQALLDHSEENEGVDCIGLFPGQVKFFGKGLIEDGEHLKVPHMGWNEVKQAVDHPLWHNIADLARFYFVHSYYINAGNTRQVVGSGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.32 kDa

MQTVAVIDYGMGNLHSVAKALEHVGAGKVLITSDAAVIREADRVVFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLDSSEENDGVDCIGLFPGAVKFFGKDLHEDGEHLKVPHMGWNEVKQAVDHPLWHNIPDLARFYFVHSYYIAAGNPRQVVGSGHYGVDFAAALAEGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.535 kDa

MQTVAVIDYGMGNLHSVAKALEHVGAGKVLVTSDASVIREADRVVFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLEHSEENAGVDCIGLFPGQVRFFGKDLQEEGEHLKVPHMGWNEVSQTIDHPLWHDIPDRARFYFVHSYYINAGKPGQVVGRGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFIAWDGRW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.575 kDa

MQTVAVIDYGMGNLHSVAKALEHVGAGRVLITSDAKVIREADRVVFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLDRSEESGGVDCIGLFPGQVKFFGKNLHEEGEHLKVPHMGWNQVTQAVDHPLWHDIPDLARFYFVHSFYIDAANQRQVVGRGHYGLDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.523 kDa

MQTVAVIDYGMGNLHSVAKALEHVGAGRVLITSDAKVIREADRIVFPGVGAIRDCMAEIRRLGFDSLVQEVSQDRPFLGICVGMQALLDSSEENGGVDCIGMFPGQVKFFGKDLHEEGEHLKVPHMGWNQVAQAVDHPLWHDIPDQARFYFVHSFYIDAANQRQVVGRGHYGLDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFAAWDGRW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.57 kDa

MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTKIFLSGDPDRVSRADKVIFPGQGAMPDCMAALTRGGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDGLGWFGGKVRRFARDLRDPQGCRLKVPHMGWNTVRQTQNHPLFQGIPQNTRFYFVHSYYFAPENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.599 kDa

MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNVEIFLSGDPERVSRADKVIFPGQGAMPDCMAALTRGGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDGLGWFGGKVRRFERDLLDPQGCRLKVPHMGWNTVRQTQNHPLFQGIPQDTRFYFVHSYYFAPENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.773 kDa

MQTAIIDYGMGNLHSVLKSVRTAGQLAGKNTEIFLSGDPDRVSRADKVIFPGQGAMPDCMAALKRDGLDEAVKDALKNKPFFGICVGAQLLFDHSEEGNTDGLGWFGGKVRRFERDLRDPQGCRLKVPHMGWNTVRQTQNHPLFKDIPQDTRFYFVHSYYFAPENPETILGESDYPSPFACIVGKDNVFATQFHTEKSHDAGLTMLKNFLNW

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.34 kDa

MNSIAVVDYGMGNLRSVSKALEYVDSSAVVTVTSDPETIRSAARVVVPGQGAMPHCMQALDDQGLRESVIEAAKNKPFLGICLGLQMLFEESEEGNIRALGILPGRVKKLESTDTADSDIPKIKIPHMGWNQVHQTLEHPLWHGIDTDTRFYFVHSYYVATDEPQIVAGSTEYPVPFTCAVARDNIFAIQFHPEKSHSAGLALLSNFLKWTP

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.171 kDa

MTDIAIVDYGMGNLRSVAKALEHVAPEAVIAVTNNPEVVRKAERVVVPGQGAMPDCLRELDRLGLREAVRDAAANKPFLGICIGLQMLFDSSEEGNVSGLGIVPGRVKRFPASAMKDEKGQKLKVPHMGWNQVHQSVGHSLWKNIANDSRFYFVHSYYVEPADADSAGHSAYPFSFTCAVAKDNIFAVQFHPEKSHAAGLTLLGNFVRWKPV

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.011 kDa

MTLIAVIDYDMGNLHSACKGLETVGAVPKITDSPLDLEKADAIVLPGVGSFDPAVRQIRSRHLEKPIKAAIANGKPFLGICLGLQILFETSEEGQEAGLGIIPGTVRRFRSEPGITIPHMGWNQLDFTQPDHALWQGLPPHPHVYFVHSYYVDPLDSHLTAATVTHGSQTVTAAIARDRLVAVQFHPEKSSTNGLKILANFVQQVQKLALVS

hisH

Imidazole glycerol phosphate synthase subunit HisH

212 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.82 kDa

MSDVAIIDYGMGNLRSVAKAIEHVAPGKRVAVTSDPAVVAAAARVVFPGQGAMPDCMRELDLRGLREVVKTAAASKPFLGICIGQQMLFEHSEEGNVPGLGILPGGVVRFPDAKMVAADGSRLKVPHMGWNEVCQRKPHPMWEGIPDNERFYFVHSYFVAPADAALVAAESDYGTRFTSAVARANIFAVQFHPEKSAQAGLKMLANFISWAP

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.382 kDa

MIGIIDYGRGNLRSVEKALWKLGYPAKVLESPAELMAVKGIILPGVGAFADAMAALEEKGWIQPLIHYAHSGKPFLGICLGMQVLFEVGEEHGEHKGLGLLPGRVVRFPAGRKIPHMGWNTLHQEKPCRLLEGIPDEAYFYFVHSYYVASEEQEILAGMSDYGVPFPALVGRDNVWGAQFHPEKSSPWGLKLLENFGKWVNEDATVSSHRS

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.385 kDa

MIGIIDYGRGNLRSVEKALWKLGYPAKVLESPAELMAVKGIILPGVGAFADAMAALEEKGWIQPLIHYAHSGMPFLGICLGMQVLFEVGEEHGEHKGLGLLPGRVVRFPAGRKIPHMGWNTLHQEKPCRLLEGIPDEAYFYFVHSYYVASEEQEILAGMSDYGVPFPALVGRDNVWGAQFHPEKSSPWGLKLLENFGKWVNEDATVSSHRS

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.824 kDa

MIGIIDYGMGNLYSVSKALERLGCPYVLSGDKEELEQARGLILPGVGSFRDAMHILNETGLAAFIRSAVENGTPLLGICLGMQLLFDESEENGPTKGLGLLRGRVVRFPGVTKTGEPYKVPHMGWNRLRFHRPSPLLRGVEEGHVYFVHSYYVIPGDEDVVLASSEYDVDVPAVVGRGCVFGTQFHPEKSGAVGMSILNNYVGIATGRGNG

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.228 kDa

MIGIIDYGMGNLYSVSKALERLRYEYIISDDPKELKNAKGLILPGVGSFKDAMHILRETGLAKFVCEAVNEGTPLLGICLGMQLLFDESEENGLTEGLGLLSGRVVRIPGVTADGNRYKVPHMGWNRLVFRHPSPLLQNVEEGHVYFVHSYYVVTDDDDVVLASSFYNVEVPAVVGKGNVYGTQFHPEKSGEIGMKILQNYASIIEGKGSM

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.624 kDa

MQPRVVILDYGSGNLRSAQRAVARVGAHATISSDPHTALEADGLVVPGVGAFAACMRGLRALRGDRVIGKRLAGGRPVLGICVGMQILFERGVENDVVTEGCAEWPGTVERLDAPVIPHMGWNTVDAPAESAMFAGIDKDTRFYFVHSYGVRTWEMQTTSPHLKPPLVTWSTHGTPFVAAVENGPLWATQFHPEKSGDAGAQLLANWVATL

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.624 kDa

MQPRVVILDYGSGNLRSAQRAVARVGAHATISSDPHTALEADGLVVPGVGAFAACMRGLRALRGDRVIGKRLAGGRPVLGICVGMQILFERGVENDVVTEGCAEWPGTVERLDAPVIPHMGWNTVDAPAESAMFAGIDKDTRFYFVHSYGVRTWEMQTTSPHLKPPLVTWSTHGTPFVAAVENGPLWATQFHPEKSGDAGAQLLANWVATL

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.597 kDa

MIAVINYGAGNLPNVVRALQRVGAKLTITDDPHVIRSAHAVVLPGVGATADTMASLQQLGIADVLPEVIAAGTPFLGICVGMQVLLSASEEFGPHPCLDIVRGTVRRLPDSAGKIPQIGWNQLRIMPNFSDHPLFVGIPNGADVYFVHSYYCDVIEETIVAARTEYGIAFPSVIIRDRLAAVQFHPEKSGDYGLRLLANFVAWSNASPARG

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.129 kDa

MTKTVALLDYGSGNLRSAQRALEHVGAEVIVTSDPDICTNADGLLVPGVGAFDACMKGLRGVFGHRIIGTRLAGGRPVMGICVGMQILFDEGIEHGIQTRGCGEWSGRVERLQARILPHMGWNTVEKQPGSEMFAGLSEDERYYFVHTYGVRDWTLVTDDLTTPPLVTWAVHENDRFVAAVENGALWATQFHPEKSGDAGAQLLRNWINHI

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.173 kDa

MTKTVALLDYGSGNLRSAQRALERAGAEVIVSSDPEVCTNADGLLVPGVGAFDACMKGLKNVFGHRIIGQRLAGGRPVMGICVGMQILFDEGDEHGIKSAGCGEWPGKVERLQAEILPHMGWNTLEMPTNSPMFEGISPDERFYFVHSYGVRKWTLETDDLTTPPEVVWAKHENDRFVAAVENGTLWATQFHPEKSGDAGAQLLRNWINYI

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.845 kDa

MTVIAVIDYDMGNLHSACKGLENAGAQTVVSDRPEDLFAADAVVLPGVGAFDPAMQHLRSRQLVPVIHDLIASGKPFLGICLGLQILFEHSEEGQEPGLGILAGTVKRFDPEPGLTIPHMGWNQLDLTQPGLPLWQQLELRPWLYFVHSYYVEPADLEVQAATITHGSQTVTAAIARNNLVAVQFHPEKSADAGLQILANFVSQIKAPVLV

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.874 kDa

MAVIAVIDYDMGNLHSACKGLENAGATPKITDSARDIEQADAIVLPGVGSFDPAVYHLRSRDLEAPLKDAIASGKPFLGICLGLQILFDASEEGSQPGLGIISGVVRRFRSEPGLTIPHMGWNQLEYTQANLPLWQELPFNPYVYFVHSYYVDPIDPSVRAATVTHGSQKVTAAIAKDNIMAVQFHPEKSSSNGLKILSNFVNQIRVKAIA

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.476 kDa

MTRKSVALLDYGSGNLHSAERALVRAGADVRVTADPDAALAVDGLVVPGVGAFAACMAGLRAVRGEKIIGQRLAGGRPVLGICVGMQILFERGVEFGVETEGCAEWPGVVERLDAPVLPHMGWNTVSAPADSVLFAGMDADTRFYFVHSYAAQRWELPPNEHFAAPKLTWAEHGVRFLAAVENGPLSATQFHPEKSGDAGAQLLRNWVDSL

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.065 kDa

MPVIAVVDYEMGNLHSVCKGLEKAGATPNVTYSPKELEQADAIVLPGVGAFDPAVQHLRARGLEQPIKDAIASGKPFLGICLGLQILFESSAEGTQPGLGIIKGKVRRFRPEPDITIPHMGWNQLEMTQAKSILWEHLPSDPWVYFVHSYYVDPIDPLIRAATITHGTQTVTAAIAHENLMAVQFHPEKSSNIGLQILSNFVAQVREKIPA

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.177 kDa

MPVVAVIDYEMGNLHSVCKGLEKAGATPIITHCHQELTKADAVILPGVGAFDPAVQSLRSRDLEQPIKDTIASGKPFLGICLGLQILFESSAEGNQPGLGIIKGKVRRFVWEPGITIPHMGWNQLELTQPKSILWEHLPPQPWVYFVHSYYVDPFEPQVRAATVTHGTQTVTAAIAHENLMAVQFHPEKSSNIGLQILSNFVSQVREKIAA

hisH

Imidazole glycerol phosphate synthase subunit HisH

211 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.015 kDa

MPVVAVIDYEMGNLHSVCKGLEKAGATPIITHSHQELTKADAVILPGVGAFDPAVQSLRSRDLEQPIKDTIASGKPFLGICLGLQILFESSAEGTQPGLGIIKGKVRRFISEPGITIPHMGWNQLELTQPKSILWEHLPPQPWVYFVHSYYVDPVEPQVRAATVTHGTQTVTAAIAHENLMAVQFHPEKSSNIGLQILSNFVSQVREKIAA

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.001 kDa

MATIAIIDYGMGNLRSVQKGFEKVGFEAVVTADPKVVLEAEKVVLPGVGAFRDCMRNLEQGGFVEPILTVIQDGRPFLGICVGMQLLFTDSVEFGLYQGLNVIPGHVLRFPEGMRERGEDLKVPHMGWNQLSIKRRPSAFSDVEDGANVYFVHSFYAKPDEEGVVAATSSYGIDFCAAVWKDNIVATQFHPEKSQAVGLSILKNFALSKA

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.466 kDa

MIAVINYGAGNLPNAVRALEYVQAPIEVVTDPAAVRAAQAVVLPGVGATADTMRSLREMGMDSAIREVIARGTPFLGICVGMQVLAEQSEEFGLHECLGLVPGTIRRFDQGLKVPQIGWNGVQHDGSALWDGIPNGAEFYFVHSYYLATDDVALVTGRTEYGLNFPAAIARDNITAVQFHPEKSGQWGLKLLGNWVELALSRGSGVGDRA

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.829 kDa

MIAILDYGMGNIHSCLKAVSLYTKDFVFTKDHSTIENSKALILPGDGHFDKAMENLNSTGLRKTIDKHVTSGKPLFGICIGFQILFESSEEIAQGSKKEQIEGLGYIKGKIKKFHGKDFKVPHIGWNRLQIRRKDKSVLLKGIGDQSFFYFIHSYRPTDAEGNAITGLCDYYQEKFPAVVEKNNIFGTQFHPEKSHTHGLKLLENFIRFI

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.497 kDa

MGYIAVVDYDMGNLHSVCKGLEKVGGNPLVTDQAHVIDGATAIVLPGVGSFDPAVQHLRARGLEEVLKTAIAKGIPFLGICLGSQLLFDSSEEGQETGLGIIPGQVKHFRSEPGLTIPHMGWNGLQFNQPDLCLWQDLPPEPQVYFVHSYYMAPLDPQVIAASTTHGSQTIAAAIAKDNVMAVQFHPEKSSTLGLKILANFVKKVALSDI

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.466 kDa

MIAVINYGAGNLPNAVRALEYVQAPIEVVTDPAAVRAAQAVVLPGVGATADTMRSLREMGMDSAIREVIARGTPFLGICVGMQVLAEQSEEFGLHECLGLVPGTIRRFDQGLKVPQIGWNGVQHDGSALWDGIPNGAEFYFVHSYYLATDDVALVTGRTEYGLNFPAAIARDNITAVQFHPEKSGQWGLKLLGNWVELALSRGSGVGDRA

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.829 kDa

MIAILDYGMGNIHSCLKAVSLYTKDFVFTKDHSTIENSKALILPGDGHFDKAMENLNSTGLRKTIDKHVTSGKPLFGICIGFQILFESSEEIAQGSKKEQIEGLGYIKGKIKKFHGKDFKVPHIGWNRLQIRRKDKSVLLKGIGDQSFFYFIHSYRPTDAEGNAITGLCDYYQEKFPAVVEKNNIFGTQFHPEKSHTHGLKLLENFIRFI

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.497 kDa

MGYIAVVDYDMGNLHSVCKGLEKVGGNPLVTDQAHVIDGATAIVLPGVGSFDPAVQHLRARGLEEVLKTAIAKGIPFLGICLGSQLLFDSSEEGQETGLGIIPGQVKHFRSEPGLTIPHMGWNGLQFNQPDLCLWQDLPPEPQVYFVHSYYMAPLDPQVIAASTTHGSQTIAAAIAKDNVMAVQFHPEKSSTLGLKILANFVKKVALSDI

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.687 kDa

MKKVALLDYGSGNLRSAQRALERVGAEVEVTNDPDVVLAADGLLVPGVGAFDACMKGLKAVQGDRMIGQRLAGGRPVMGICVGMQIMFDSGNEHGISAAGCGQWPGNVEKLEARVLPHMGWNTVEAAQDSQLFAGLDADTRFYFVHSYGVRWWEFEGDGLTRAPLVTWAQHESDRFVAAVENGALMATQFHPEKSGDAGAQLLRNWIDLL

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.896 kDa

MASTNQKVVIIDTGCANVSSVRFAIERLGYTVTISKETSVVLNADKLFLPGVGTASEAMKNLQERDLVELVKQVDKPLLGICLGMQLLGALSEEQGQNGKELVPCLHLCDAPIKKLKTGNLPLPHMGWNTITPIDNHPLFQGIPAGSYFYFVHSYAMPVSTGVNDYTIAQCEYGQPFSAAIQSGNYYGVQFHPERSSKAGSQLIKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.829 kDa

MIAILDYGMGNIHSCLKAVSLYTKDFVFTKDHSTIENSKALILPGDGHFDKAMENLNSTGLRKTIDKHVTSGKPLFGICIGFQILFESSEEIAQGSKKEQIEGLGYIKGKIKKFHGKDFKVPHIGWNRLQIRRKDKSVLLKGIGDQSFFYFIHSYRPTDAEGNAITGLCDYYQEKFPAVVEKNNIFGTQFHPEKSHTHGLKLLENFIRFI

hisH

Imidazole glycerol phosphate synthase subunit HisH

210 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.59 kDa

MRPIAIIDYGMGNLLSVQKALDRLGYPVEVTDDPGEITAAPGVILPGVGAFADAMANLQQKGLVAAIREVAERGVPLLGICLGLQLLFSTSEEGGQVAGLDLLPGEVKRLPAGIKVPHMGWNQVRFPRPGALFRGIPGGTDFYFVHSYYIVPREEEVVTGTTEYGLEFAVSIQRGNLFGVQFHPEKSSRRGLEVLKNFGELVRHAGNAGH

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.185 kDa

MTKIAIIDYGMGNLRSVQKGFEKVGFEAVVTADPKVVLEAEKIVLPGVGAFRDCMRNLEQGGFVEPILRVIREGRPFLGICVGMQLLLTDSVEFGLYQGLNVIPGHVLRFPEGMREGGEELKVPHMGWNQLSIKRRPPAFAEVEDGANVYFVHSYYEMPDDESVIAATCTYGVEFCAAIWKDNIVATQFHPEKSQAVGLSILKNFGEMK

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.361 kDa

MSRPVVVFEYGSGNVHSAVKALEAAGADVELTRDRRRAQEADGLVVPGVGAFAAVVDRLRAAHGDEIIERRLAGGRPVLGICVGMQVMFERGTEHGQETAGLGEWPGAVEPLCAGVVPHVGWNAVEAPADSVLFDGVWDERFYFVHSYAAQHWTLEATGPFPKPRVSWAEHGSRFVAAVENGPLSATQFHPEKSGSAGLRLLANWIGSL

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.609 kDa

MSAPAIAIIDYDMGNLHSVSKALEVVGARPLISDRPAEIFAADAVVLPGVGAFDPAMARLQERELVPVIEQIIEQGMPFLGICLGLQVLFECSEEGTEPGLGIFAGKVKRFQSEPGLTIPHMGWNQLTLRPSASPLWQHLPPSPWVYFVHSYFVAPEDPSLVAATVCHGQQTVTAAIARNNLFACQFHPEKSGAVGLQLLRNFVALVKD

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.361 kDa

MSRPVVVFEYGSGNVHSAVKALEAAGADVELTRDRRRAQEADGLVVPGVGAFAAVVDRLRAAHGDEIIERRLAGGRPVLGICVGMQVMFERGTEHGQETAGLGEWPGAVEPLCAGVVPHVGWNAVEAPADSVLFDGVWDERFYFVHSYAAQHWTLEATGPFPKPRVSWAEHGSRFVAAVENGPLSATQFHPEKSGSAGLRLLANWIGSL

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.609 kDa

MSAPAIAIIDYDMGNLHSVSKALEVVGARPLISDRPAEIFAADAVVLPGVGAFDPAMARLQERELVPVIEQIIEQGMPFLGICLGLQVLFECSEEGTEPGLGIFAGKVKRFQSEPGLTIPHMGWNQLTLRPSASPLWQHLPPSPWVYFVHSYFVAPEDPSLVAATVCHGQQTVTAAIARNNLFACQFHPEKSGAVGLQLLRNFVALVKD

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.245 kDa

MIAIIDYGMGNIRSVEQALKYIGAEYIVTSDKKEILRSDGVILPGVGAFPKAMDVLEERDLVCVLKEVCDIGKPLLGICLGMQLLFERSEELKDCSGLGLLPGEIRKLKVSYKIPHMGWNELRKEREFPLWNGLVDGSFVYYVHSYYADCPDEIVCGVSDYGMQVPGFVAKGNVFGAQFHPEKSGEIGMQILKNFQGVVEAWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.268 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQILKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.263 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGCSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDSSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.14 kDa

MIAIIDYGMGNIRSVEQALKYIGTEYIITDDKKEILRSDGVILPGVGTFPKAMGVLEEKDLVCVLKEVGSLGKPLLGICLGMQLLFEKSEELQNCNGLNLLPGVIRKLKVPYKIPHMGWNELKKEGEISLWNGVEDGSFVYYVHSYYADCPNEIVYGASEYGVKVPGFVAKGNIFGAQFHPEKSGEIGMRMLKNFKGVVEAWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.512 kDa

MTKIGLIDYGMGNLFSVQQAFKRFNQPLDIISDIKTLQSCDALILPGVGAFDPAMMNLRKTELVPSIIDWVNNGKPLFGICLGLQLLFEASDEGTSEGLGVIKGHIRRLPQEKDERIPHIGWSPIYKTNECPILENYPGSNWMYFVHSYSACPLEPKHTVAVTKFGKTDVSSMVWHKNTGACQFHPEKSGVAGQKIIFNWINWLKKNKF

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.187 kDa

MSSVAVIDYGMGNLRSVSKALEQVAGKVRIDVTSNPQRIRAADRVVFPGVGAIRDCMHELRRLNLDIVVAQCAADRPFLGICLGLQALLELSEENHGVPCLGILPGRVQRFDAVKADLKVPHMGWNQAHQVRAHPLWNAIPQNCRFYFVHSYYTVPDETSLVASRTDYSTSFASALARDNIFAVQFHPEKSHTFGLQLLANFLTWNGVS

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.286 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.318 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRMLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.268 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQILKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.286 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.273 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGVSDYGVEVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.304 kDa

MIAIIDYGMGNIRSVEQALKHIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDVLEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKENIYGAQFHPEKSGDIGMQMLKNFKGVVESWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.204 kDa

MIAIIDYGMGNIRSVEQALKYIGAEHIVTSDKEEILRSDGVILPGVGAFPKAMEVLEERDLVCVLKEVCDIGKPLLGICLGMQLLFERSEELKGCSGLGLLPGEIRKLKVSYKIPHMGWNELRKEREFPLWNGLVDGSFVYYVHSYYADCPDEIVCGVSDYGMQVPGFVAKGNVFGAQFHPEKSGEIGMQILKNFQGVVEAWKSSRLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.268 kDa

MIAIIDYGMGNIRSVEQALKYIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDILEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISDYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQILKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.244 kDa

MIAIIDYGMGNIRSVEQALKYIGAEYIVTSNKKEILRSDGVILPGVGAFPKAMDVLEERDLVCVLKEVCDIGKPLLGICLGMQLLFERSEELKDCSGLGLLPGEIRKLKVSYKIPHMGWNELRKEREFPLWNGLVDGSFVYYVHSYYADCPDEIVCGVSDYGMQVPGFVAKGNVFGAQFHPEKSGEIGMQILKNFQGVVEAWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.26 kDa

MIAIIDYGMGNIRSVEQALKHIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDVLEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISEYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.946 kDa

MIAIIDYGMGNIRSIEQALTSIGVEHLVTDRQREIVKSDGVILPGVGAFPKAMEALEAKKLVTVLQECGKTGKPLLGICLGMQLLFEKSEEMKSSNGLGLLPGVVRKLQVPYKIPHMGWNRLTKTKEMPIWNRVADGSFVYYVHSYYAECPNDMICGTSEYGISVPGLVAKGNIFGAQFHPEKSGEIGIQMLANFKGVVKQWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

209 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.26 kDa

MIAIIDYGMGNIRSVEQALKHIGAAYIVTSDKEEIFRSDGVILPGVGAFPKAMDVLEEKDLVRVLQEIGRSRKPLLGICLGMQLLFEKSEELQDCNGLSLLPGVIRKLKVPYKIPHMGWNELKKEGEIALWNGVEDGSFVYYVHSYYADCPNEIVYGISEYGVKVPGFVAKGNIYGAQFHPEKSGDIGMQMLKNFKGVVETWKSSQLSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.323 kDa

MIVIVDYDTGNTRNVKKALDYLGVNNQLSADPAIIMAASGLILPGVGAFKEAMKALNQRQLVPVIQAFAATGKPLLGICLGMQLLFDRSFEFGETAGLGLIPGEVVAIPTDSGLAVPHMGWNTNSLTQPDLFAAVFADQATYFVHSFYATTLPQFTLATTDYGQPLTSIVRRNNVLGTQFHPEKSGAIGLAGLKKFKEMTEDEALSRD

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.323 kDa

MIVIVDYDTGNTRNVKKALDYLGVNNQLSADPAIIMAASGLILPGVGAFKEAMKALNQRQLVPVIQAFAATGKPLLGICLGMQLLFDRSFEFGETAGLGLIPGEVVAIPTDSGLAVPHMGWNTNSLTQPDLFAAVFADQATYFVHSFYATTLPQFTLATTDYGQPLTSIVRRNNVLGTQFHPEKSGAIGLAGLKKFKEMTEDEALSRD

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.347 kDa

MFAIVDYDTGNTRNLKKAFDYLQVSTILTADPQQLAAADAVILPGVGAFAAAMAALKERQLVGVLQALARSGKPVLGICLGMQLLFESSSEYGEHAGLGLLSGRVSALPTDLNVKVPQMGWNQNELRRPDSPFASIDAAYTYFVHSYYAVCPATEIVATVQHGVQVPSIVQQQNVIGMQFHPEKSGRVGLQQLAAFKEMVSANDFSSN

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.323 kDa

MIVIVDYDTGNTRNVKKALDYLGVNNQLSADPAIIMAASGLILPGVGAFKEAMKALNQRQLVPVIQAFAATGKPLLGICLGMQLLFDRSFEFGETAGLGLIPGEVVAIPTDSGLAVPHMGWNTNSLTQPDLFAAVFADQATYFVHSFYATTLPQFTLATTDYGQPLTSIVRRNNVLGTQFHPEKSGAIGLAGLKKFKEMTEDEALSRD

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.323 kDa

MIVIVDYDTGNTRNVKKALDYLGVNNQLSADPAIIMAASGLILPGVGAFKEAMKALNQRQLVPVIQAFAATGKPLLGICLGMQLLFDRSFEFGETAGLGLIPGEVVAIPTDSGLAVPHMGWNTNSLTQPDLFAAVFADQATYFVHSFYATTLPQFTLATTDYGQPLTSIVRRNNVLGTQFHPEKSGAIGLAGLKKFKEMTEDEALSRD

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.347 kDa

MFAIVDYDTGNTRNLKKAFDYLQVSTILTADPQQLAAADAVILPGVGAFAAAMAALKERQLVGVLQALARSGKPVLGICLGMQLLFESSSEYGEHAGLGLLSGRVSALPTDLNVKVPQMGWNQNELRRPDSPFASIDAAYTYFVHSYYAVCPATEIVATVQHGVQVPSIVQQQNVIGMQFHPEKSGRVGLQQLAAFKEMVSANDFSSN

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.187 kDa

MNVTIVDYNSGNISSVINSFKEVAKDKVNIEVTSDLNKIRSSDKVVLPGQGSFKSCVDALNAINGLVETLNEFTVTNKKPLLGICVGLQMFADLGYEETETKGLGWISGKVSKIDNQNNKFKLPHIGWNEINIVKESKIFEGIKNKSHMYFVHSYEFIPDDKSVISATTDYSSNIVCSVEKENIFGTQFHPEKSDKLGLKIIENFLNL

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.734 kDa

MIVIIDYDTGNTKSISKALDFIGLQNKISSNHAEILQADGVILPGVGAFPEAMQELGRRGLDVTLKEMAESGKPMLGVCLGMQLLLESSDEHLFTKGLGLIPGHVEKLPDEPGFAVPHMGWNQLEIKRSTPLTKKLGGEYVYYVHSYYANCPNEYIIATSGYSVEVPSMINKGNIYGAQFHPEKSGQIGLEILKGFKEVTESCKSSQQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.756 kDa

MIVIIDYDTGNTKSISKALDFIGLQNKISSDKTEIAQADGVILPGVGAYPEAMQELTRRGLDKTLKEIATAGKPILGVCLGMQLLLESSNEHSYTKGLGLIPGHVEMLPDESEFAVPHMGWNQLQIKRTTPLTQNIAGEYVYYVHSYYANCPEAYIIATSGYSIDIPGMINNGNIYGAQFHPEKSGQIGLEILKGFKEVIRSCKSSQQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.756 kDa

MIVIIDYDTGNTKSISKALDFIGLQNKISSDKTEIAQADGVILPGVGAYPEAMQELTRRGLDKTLKEIATAGKPILGVCLGMQLLLESSNEHSYTKGLGLIPGHVEMLPDESEFAVPHMGWNQLQIKRTTPLTQNIAGEYVYYVHSYYANCPEAYIIATSGYSIDIPGMINNGNIYGAQFHPEKSGQIGLEILKGFKEVIRSCKSSQQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.76 kDa

MIVIIDYDTGNTKSISKALDFIGLQNKISSDATEISQADGVILPGVGAYPEAMKELTRRGLDKTLKEIAATGKPILGVCLGMQLLLESSNEHSFTSGLGLIPGHVEKLPEEPEFAVPHMGWNQLQIKRATPLTKQLDGEYVYYVHSYYANCPEEYIIATSGYSIEVPGMINNGNIYGAQFHPEKSGQIGLEILKGFKEVTYSCKSSQQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.742 kDa

MIVIIDYDTGNTKSISKALDFIGLQNKISSDATEISQADGVILPGVGAYPEAMKELTRRGLNKTLKEIAAGGKPILGVCLGMQLLLESSNEHSFTNGLGLIPGHVEKLPEDPEFAVPHMGWNQLQIKRATPLTKQLDGEYVYYVHSYYANCPEEYIIATSGYSIEVPGMINKGNIYGAQFHPEKSGQIGLEILKGFKEVTYSCKSSQQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

208 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.082 kDa

MIVIIDYDTGNTKSISKALDFIGLQNKISSNKTEILQADGVILPGVGAYPEAMQELIRRGLDVTLKEIAVLRKPILGVCLGMQLLLESSNEHVFTRGLGLIPGYAEKLPDEPKFVIPHMGWNQLENKRITPLTKKVDGEYVYYVHSYYANCPPEYIIATSGYSVEIPGMINNGHIYGAQFHPEKSGQIGLEILKGFKEVIRSCKSSLQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

207 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.747 kDa

MIGIIDYGMGNLHSVSKALERLAIPYFISSDGEELAKAKALILPGVGAFPDAMNILTQTNVQPFLDNWVAENKPLLGICLGMQLLFESSNEHQPTAGLGYLPGRVERFSGTTAEGHAYKVPHMGWNKLEFHRPTPLTEGVPDGYVYFVHSYVVRTETDIVVASSDYYQSVPAIVQKGQVYGMQFHPEKSSTVGMALLKRFGQLVEGN

hisH

Imidazole glycerol phosphate synthase subunit HisH

207 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

23.307 kDa

MRTVVIDYGMGNLRSVSKALEAVGFPEVVVSNDYRVASEADVLVLPGVGAFGDAMKNLEELNLVSVIRRHIEKGKPFLGICLGLQLLFEKSYEHGEHRGLGILKGEVILLPLGVKIPHIGWNQLWFKKESEILEGLKEGDFVYFVHSYRVVPEDESVVLTKTDYGEYFVSSIELDNVVAFQFHPEKSQKKGLKLLENFKRKAEKLTT

hisH

Imidazole glycerol phosphate synthase subunit hisH

206 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.294 kDa

MKVGLVDYSMGNMHSVSRAIQQANQQVCVVRSESELAQVHILVVPGVGHFDLAMKKLEQKGLRTGIAKWIAKGNPYIGICLGMHILFETSEEGKEEGLGVYKEQVKRLPVKVIPHMGWNRLECQNSECQNSEWVNWKAWPNAWAYFVHSYGVMASSQACATTTYEKIQMVAAIEKDNCFAMQFHPEKSGEFGLWLWREVMKKAASL

hisH

Imidazole glycerol phosphate synthase subunit HisH

206 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.784 kDa

MTSKSVVVLDYGSGNLRSAQRALERVGASVQVTADADAAAAADGLVVPGVGAYEACMTGLRKIGGDRIIAERVAAGRPVLGVCVGMQILFARGVEFSVETSGCGQWPGSVTRLQAPVIPHMGWNVVESGPDSVLFRGLDADTRFYFVHSYAAQQWEGSPEAVLTWSRHEGPFLAAVEDGPLSATQFHPEKSGDAGAAVLRNWIERL

hisH

Imidazole glycerol phosphate synthase subunit HisH

206 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.446 kDa

MTAKSVVVLDYGSGNLRSAQRALQRVGAEVEVTADTDAAMTADGLVVPGVGAFAACMAGLRKISGERIIAERVAAGRPVLGVCVGMQILFACGVEFGVQTPGCGHWPGAVIRLEAPVIPHMGWNVVDSAAGSALFKGLDVDARFYFVHSYAAQRWEGSPDALLTWATYRAPFLAAVEDGALAATQFHPEKSGDAGAAVLSNWVDGL

hisH

Imidazole glycerol phosphate synthase subunit HisH

206 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.418 kDa

MTAKSVVVLDYGSGNLRSAQRALQRVGAEVEVTADTDAAMTADGLVVPGVGAFAACMAGLRKISGERIIAERVAAGRPVLGVCVGMQILFACGVEFGVQTPGCGHWPGAVIRLEAPVIPHMGWNVVDSAAGSALFKGLDVDARFYFVHSYAAQRWEGSPDALLTWATYRAPFLAAVEDGALAATQFHPEKSGDAGAAVLSSWVDGL

hisH

Imidazole glycerol phosphate synthase subunit HisH

206 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.757 kDa

MIVIIDYGMGNLRSVQKGFEKVGYSARVTDDPAVVAQADKLVLPGVGAFRDCMDQLTAGGFVEPILRHVESGRPFLGICLGLQLLFTESEEFGHHQGLNIIPGRVVRFPGDMQEQGEVLKVPHMGWNQIDIQRPAPIFQGLDSGESVYFVHSYYVVPEDASVVAATADYGRTFCAAVWRDNVMATQFHPEKSQQVGLRILKNFGDM

hisH

Imidazole glycerol phosphate synthase subunit HisH

206 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.446 kDa

MTAKSVVVLDYGSGNLRSAQRALQRVGAEVEVTADTDAAMTADGLVVPGVGAFAACMAGLRKISGERIIAERVAAGRPVLGVCVGMQILFACGVEFGVQTPGCGHWPGAVIRLEAPVIPHMGWNVVDSAAGSALFKGLDVDARFYFVHSYAAQRWEGSPDALLTWATYRAPFLAAVEDGALAATQFHPEKSGDAGAAVLSNWVDGL

hisH

Imidazole glycerol phosphate synthase subunit HisH

206 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.652 kDa

MRSKSVVVLDYGSGNLWSVQRALQRVGAAVEVTADSAAGAAADGLLVPGVGAFEACMAGLRKIAGERTIAERIVAGRPVLGVCVGMQILFARGVEFGVETTGCRQWPGVVTRLDAPVVPHMGWNVVDSASGSALFKGLDAGVRFYFVHSYAAQRWEGSSKALLTWATHQVPFLAAVEEGPLVATQFHPEKSGDAGATLLSNWLGEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.132 kDa

MIALVDYGGGNLKSVANAIHALGYEFKLTSSPEEILSAEAVILPGVGAAADTMAGLQSKGLDKAIKELVARDIPLLAICVGMQVLFDYTAEGDNTKCLGILKGDVKRLPEGLKIPQMGWNQLKQRVSHPIFEGIPDGIDFYFVHSYYASPADPGIIGATTDYGVDFCSLVISKRLIATQFHPEKSGSYGLKLYQNFFKMALGDKK

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.167 kDa

MIALVDYGGGNLKSVANAIHALGYEFTLTSDPKEILSAQAVILPGVGAAADTVAGLRAKGLDEAIKELVKRDIPLLAICVGMQVLFDSTEEGGQTKCLGILAGEVKRLPDGVKIPQMGWNQLKQRVSHPLFEGIPDGTDFYFVHSYYASPADRNIIGATTDYGVDFCSLVINKRLIATQFHPEKSGSYGLKLYQNFFKMALGDKK

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.785 kDa

MVGIVNYNIGNLASVLNALVKVGAKAQIEKEPSRLLEYDRLILPGVGAFGDAMEHLVQSGMKEAVLEFAKSGKPLLGICLGMQLLFEKSYEFGEHAGLGLLEGEIIPFDKTRMGEGYKIPQMGWNRFYAKKKSPLLKGLEEGFYLYYVHSFHAVAKREEDVLGESVYGYPFVSAIERDNVAGFQPHPEKSHDVGLRILKNFCEIG

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.785 kDa

MVGIVNYNIGNLASVLNALVKVGAKAQIEKEPSRLLEYDRLILPGVGAFGDAMEHLVQSGMKEAVLEFAKSGKPLLGICLGMQLLFEKSYEFGEHAGLGLLEGEIIPFDKTRMGEGYKIPQMGWNRFYAKKKSPLLKGLEEGFYLYYVHSFHAVAKREEDVLGESVYGYPFVSAIERDNVAGFQPHPEKSHDVGLRILKNFCEIG

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.013 kDa

MSDPVRVGIIDHGSGNLHSARRALRQVGAEVIVSNDPSALLDTDALVLPGVGALAVCMTGLRAMGGARLVRQWVDEGRPLLGICVGHQMLFERGRERDVDVKCLGVLPGVVEELPAERLPHMGWNTVTPATDSALFQGVQERFYFVHSYGVVVTGPHDHFTTATHQGATFVAAAEYGPVTSTQFHPEKSGIAGLALLTRWLNQLS

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.875 kDa

MHKIGLIDYGMGNIHSVTKSLESLGEEIILIKNFSESKACKAIILPGVGAFDPAMINLINTDLIIDLKNWINSGKSFLGICLGLQLLFESSDEGKVQGLGILKGKIQKIPNIVNQRIPHMGWCELLPTKTNTLLELEELNNWVYFVHSYHAIPDDFSIIAAQVNYGSEKLTAMIENDNLLACQFHPEKSGKTGEKLLRRWLSNIQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.922 kDa

MAKIGLIDYGMGNIHSVTKALESLEEEIILIKNNHQIKDCKALILPGVGSFDPAINNLSKTELIIDIKNWIKSGKSFLGICLGLQLLFESSDEGTINGLGIVKGQIKKIPQLSDQRIPHVGWCELLPTRKNSLLKVDELNNWVYFVHSYHAVPSNNNLITANVSYGSEKLTAMIERDNLMACQFHPEKSGKTGEKLLRRWIKSIQ

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.047 kDa

MITIVDYQMGNLRSVQKAVERSGVEAEITSDASQIAAAERLILPGVGAFGDAIGEIRRRDLEKPIKDFIASGKPFLGICLGLQMLFEQGFEGGTHEGLGVLGGDVVAFELPAEFKVPHMGWNAVDVKDAGADLGIQSGTHFYFVHSYFVRPADPSVVALTCDYGGEFCAAVRRGNLMATQFHPEKSQGDGLRLMQRFATAPVEVA

hisH

Imidazole glycerol phosphate synthase subunit HisH

205 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.72 kDa

MTRIALLDYGMGNLHSAAKALEHVGATVDVTNDPKLIAKADKIVFPGVGAMRDCMQGMHEAGIDEVVRQAVFNKPVLAICVGMQALLESSEENGGVPALGIFEGAVKHFPDLGHLKVPHMGWNQVYQNDPAHPMWNNIDQDSRFYFVHSYYVEPKQSDLIAATCDYGLQFCTAIHKDNLFATQFHPEKSHTAGLQLLKNFVEWNI

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.841 kDa

MIGILDYGVGNLKAFANVLKGLNFHHQIVKTEQELKGCEKIIMPGVGSFDSVMNKLIESGIRDVLSDLIINKKIPILGVCVGMQILASSSEEGSKSGLGWIRGRVKKFNFDRSDFSLTIPQIGWNEVNSTKENTLLKNLEKNPRFYFLHSYYIECEDKKDVIAIANYGGDFTCAVNRENIYGTQFHPEKSHHNGVALIRNFASL

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.345 kDa

MTEQKVVIIDTGCANVSSVKFAIERLGYDVTISKDPQVVLSADKLFLPGVGTASEAMKNLEERDLINLVKQVEKPLLGICLGMQLLGKFSQEKGQKADELVECLGLCDGEVKLLQTGDLPLPHMGWNTVSAKAGNPLFKDIEEGEYFYFVHSFAMPVGDYTIAECDYGNPFTAAVQSGNYYGVQFHPERSSKAGAKLIQNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.216 kDa

MTEQKVVIIDTGCANVSSVKFAIERLGYDVTISKDPQVVLSADKLFLPGVGTASEAMKNLEERDLISLVKQVEKPLLGICLGMQLLGKVSQEKGQKADELVECLGLCDGEVKLLQTGDLPLPHMGWNTVSAKAGNPLFKGIEEGEYFYFVHSFAMPVGDYTIAECEYGNSFTAAVQSGNYYGVQFHPERSSKAGAKLIQNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.841 kDa

MIGILDYGVGNLKAFANVLKGLNFHHQIVKTEQELKGCEKIIMPGVGSFDSVMNKLIESGIRDVLSDLIINKKIPILGVCVGMQILASSSEEGSKSGLGWIRGRVKKFNFDRSDFSLTIPQIGWNEVNSTKENTLLKNLEKNPRFYFLHSYYIECEDKKDVIAIANYGGDFTCAVNRENIYGTQFHPEKSHHNGVALIRNFASL

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.345 kDa

MTEQKVVIIDTGCANVSSVKFAIERLGYDVTISKDPQVVLSADKLFLPGVGTASEAMKNLEERDLINLVKQVEKPLLGICLGMQLLGKFSQEKGQKADELVECLGLCDGEVKLLQTGDLPLPHMGWNTVSAKAGNPLFKDIEEGEYFYFVHSFAMPVGDYTIAECDYGNPFTAAVQSGNYYGVQFHPERSSKAGAKLIQNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.216 kDa

MTEQKVVIIDTGCANVSSVKFAIERLGYDVTISKDPQVVLSADKLFLPGVGTASEAMKNLEERDLISLVKQVEKPLLGICLGMQLLGKVSQEKGQKADELVECLGLCDGEVKLLQTGDLPLPHMGWNTVSAKAGNPLFKGIEEGEYFYFVHSFAMPVGDYTIAECEYGNSFTAAVQSGNYYGVQFHPERSSKAGAKLIQNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.493 kDa

MIKIVDYGLGNIQAFANLYKRLHIPVVVARTADELAGATKIILPGVGAFDHAMARLNESGMREILESLVQKDKVPVLGICVGMQMLANSSDEGVLPGLGWVPGRVREFRNIPGLEGIAQPHMGWNDVKPVVSSGLFKGLETDARFYFLHSFFFECQNPDYSLASANYGLEFSCAVANRNVYGVQFHPEKSHDFGMTLLKNFSEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.75 kDa

MIGILDYGVGNLKAFANVLKDLNFRNQIVKTEQELKSCTKIIMPGVGSFDSVMDKLSESGIRDVLSDLVMSKKIPVLGVCVGMQILASSSEEGTKSGLGWIQGKVKKFNFDQSNSLLTVPQIGWNEVTSIRDNKLLLNLEKNPRFYFLHSYYMECEEDNDVIAFADYGGNFTCAVNRDNIFGTQFHPEKSHHNGVALLRNFASL

hisH

Imidazole glycerol phosphate synthase subunit HisH

204 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.462 kDa

MTNQNVVIIDTGCSNVSSVRFAIERLGYEVTISRDPQVVLAADKLFLPGVGTASEAMKNLAERDLIELVKQVEKPLLGICLGMQLLGKLSEEKGQKADQIVDCLGLCDGEVRKLQTGDLPLPHMGWNTIKPVEGNPLFKDIPENSYFYFVHSFGMQVGDYTIASCDYGQPFTAALQAGNYYGVQFHPERSSKVGSKLIQNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

203 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.274 kDa

MTQNVVIIDTGCANISSVKFAIERLGYAVTISRDPQVVLAADKLFLPGVGTASEAMKNLTERDLIELVKRVEKPLLGICLGMQLLGKLSEEKGQKADEIVQCLGLVDGEVRLLQTGDLPLPHMGWNTVQVKEGHPLFNGIEPDAYFYFVHSFAMPVGDYTIAQCEYGQPFSAAIQAGNYYGVQFHPERSSKAGARLIQNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

203 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.274 kDa

MTQNVVIIDTGCANISSVKFAIERLGYAVTISRDPQVVLAADKLFLPGVGTASEAMKNLTERDLIELVKRVEKPLLGICLGMQLLGKLSEEKGQKADEIVQCLGLVDGEVRLLQTGDLPLPHMGWNTVQVKEGHPLFNGIEPDAYFYFVHSFAMPVGDYTIAQCEYGQPFSAAIQAGNYYGVQFHPERSSKAGARLIQNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

203 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.518 kDa

MNKKIAIIDYDMGNLLSVKKAFDYIGANSFITSDSKEIEKSDAIILPGVGAFPDAMSSLKENGIDKTIINEAKNGKPFAGICLGMQLLFDESEEVTNTKGLGLIGGKIRKMKTEFKIPHMGWNSLNIPRECNILKGVSKGSYVYFVHSYYAELADKNNLNAYCDYGTKLPAVVSYKNIFGIQFHPEKSGEIGLTILKNFWELI

hisH

Imidazole glycerol phosphate synthase subunit HisH

203 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.545 kDa

MIGIIDYGMGNLRSVEKALKYVGYDAKITSDAKEIKNFEALILPGVGAFPDAIRVLIKTGMAEEIKIHIEKGKPFLGICLGMQLLFEKSFEGGKTEGLKIFKGNVVGLPKGNKIPHVGWNSLTIKKDTPFLKGIKNGDYVYFVHSYYVNGNEKDFEYAVTEYGIEIPAVIIKDNVFSCQFHPEKSGETGLKILKNFGEMIKCL

hisH

Imidazole glycerol phosphate synthase subunit HisH

202 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.454 kDa

MKKIVIIDYNIGNLQSVQAAFLRLGQETVISRDLEEIRKADALILPGVGAFPTAMNNLKKFNLIELIQERAAAGIPILGICLGMQVLFEKGYEIEERQGLGLLKGEVIPIKTNEKIPHMGWNQLNLAKASPTTHYLSDNDEVYFVHSYQATCPDDELIAYTTYGEVKIPAIVGKNNVIGCQFHPEKSGEIGRKVLKAFLEEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

202 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.454 kDa

MKKIVIIDYNIGNLQSVQAAFLRLGQETVISRDLEEIRKADALILPGVGAFPTAMNNLKKFNLIELIQERAAAGIPILGICLGMQVLFEKGYEIEERQGLGLLKGEVIPIKTNEKIPHMGWNQLNLAKASPTTHYLSDNDEVYFVHSYQATCPDDELIAYTTYGEVKIPAIVGKNNVIGCQFHPEKSGEIGRKVLKAFLEEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

202 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.86 kDa

MKRIVIIDYGLGNLRSVQKGLEHVGANPAISGNPEEILTADGIILPGVGAFIDAMKCLIPLKGVIAEFAESGKPMLGICLGQQVLMSSSEEGRLTGGLDLIQGRVLRFPKSELKVPHMGWNNIRIKQDHPLFKGISDGSFVYFVHSYYVDTTAENTLASCEYGLDFSASVVNSKGNVMGTQFHPEKSGTTGLKILKNFVEMC

hisH

Imidazole glycerol phosphate synthase subunit HisH

202 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.817 kDa

MKRIVILDYGLGNLRSVQKGLEHVGSSPAISGDPEEILAADGLILPGVGAFVDAMKCLDPIKGTIEEYARSGKPMLGICLGQQVLMSSSEEGKLTDGLDLISGKVLRFPKSELKVPHIGWNNIKIKQDHPLFEGIPDNSFVYFVHSFYVDTASENTLASCNYGLDFSASVVNSKGNVMGTQFHPEKSGAIGLKILKNFVDMC

hisH

Imidazole glycerol phosphate synthase subunit HisH

202 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.861 kDa

MKRIVIIDYGLGNLRSVQKGLEHAGASPAISGNPEEILAADGIILPGVGAFIDAMKCLVPLKKTIAEFAESGKPMLGICLGQQVLMSSSEEGRLTDGLDLIQGRVLRFPKSELKVPQMGWNNIRVKQDHPLFKGIPDGSFVYFVHSYYVDTAAENTLASCEYGLEYAASVVNSKGNVMGTQFHPEKSGATGLKILRNFVEMC

hisH

Imidazole glycerol phosphate synthase subunit HisH

201 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.097 kDa

MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR

hisH

Imidazole glycerol phosphate synthase subunit HisH

201 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

23.097 kDa

MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSRR

hisH

Imidazole glycerol phosphate synthase subunit HisH

201 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.811 kDa

MVFIADYGAGNLRSVLKAFEFLGIKAIVSNDPRKMAGYRKVLLPGVGAFGQAMQSLEALGFVSALLEHVDKGGHLLGICLGMQLLLSESEEMGTHKGLNLVPGKVKHFVSSSDKIPQIGWNAVDFSKQSDLFRNVADHSFFYFVHSYYCETESVEAVAATTLFAGQNFCSAIEKNGIFAVQFHPEKSADAGLKVLANFAEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

201 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.835 kDa

MVFIADYGAGNLRSVQKAFDYLGIPATVSSDPAKMAGCRKVVLPGVGAFGQAIEALDRLGFTDALSEHVDKGGHLFGICLGMQLMLSDSEEMGSHRGLGLIPGSVRHFQSDSDKIPQIGWNSIDLKQESVLFRGIADHSFFYFVHSYYCDPLEASSIASTTWFAGKNFCSAIEKNGIFAVQFHPEKSSEAGLQVLRNFAEC

hisH

Imidazole glycerol phosphate synthase subunit HisH

201 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.259 kDa

MVFIADYGAGNLRSVHKAFDYLGIEAVVSDKASEMSRYDKVLIPGVGAFGPAMEALNRQGFDEAIREHIDKGRSVLGICLGMQLFLSESEEMGAYKGLDIVPGKVLRFTSSTDKIPQIGWNSVDYCKDSVLFRNVPDQSYFYFVHSYYCAPDEPESVAATTFFAGKKFCSAIEKNGIFAVQFHPEKSSEAGLQVLKNFAEF

hisH

Imidazole glycerol phosphate synthase subunit HisH

201 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.322 kDa

MIAIIDYGAGNIKSLQFALDKLNKHSIVTTEAAEIKQADSIILPGVGAFKDAMEAIRQLQLDSVIQEEAQKGKPILGICLGMQLFYEQSLENGDWEGLGLLKGSIKRISGEVKVPHMGWNTLDIQQASPLFDSKLENPYVYFVHSYAVSSFEENTLLASSQYGQLIPAIVQKGNITGMQFHPEKSGEFGIELLKRYEEMIR

hisH

Imidazole glycerol phosphate synthase subunit HisH

201 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.85 kDa

MKVVILDTGCANLSSVTYAIRKLGYQPEISQETATILAADKLLLPGVGTASAAMDQLKQRELIPLIKVLSQPVLGICLGMQLFAATSEESDNVAGNNVTLLEVMASPVQKMATHGLPLPHMGWNQVLPKAGHPLFRGIEDHAYFYFVHSYAIPLNTYTIAQTEYGNIFSSAIAKDNFFGVQFHPERSGAAGARLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.819 kDa

MRMKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAPQFHPEKSGKAGLAFLALARRYFEVL

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.27 kDa

MTDVALIDAGGANLGSVRYALERLGVDARLVRDAAGLQGAQRVILPGVGAAPEAMSRLRAQGLVEPLRELQVPLIGICLGMQLLFEHSEEGDVECLGLLPGIVRHMTPALGIRIPHMGWNQLVPMRDSALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQNGLRCGAQFHPERSAETGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.223 kDa

MTDVALIDAGGANLGSVRYALERLGVDARVVRDAAGLHGAQRVILPGVGAAPEAMSRLRTQGLVEPLRALQVPLIGICLGMQLLFEHSEEGDVECLGLLPGIVRHMTPALGIRVPHMGWNQLVPMRESALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQNGLRCGAQFHPERSADTGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.26 kDa

MTDLALIDAGGANLGSVRYALERLGVEARVVRDAQGLQGAERVILPGVGAAPEAMARLRAQGLIEPLQQLQVPLIGICLGMQLLFEHSEEGDVDCLGMLPGIVRHMTPALGIRVPHMGWNQLVPMRDSALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQSGLRCGAQFHPERSADTGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.26 kDa

MTDLALIDAGGANLGSVRYALERLGVEARVVRDAQGLQGAERVILPGVGAAPEAMARLRAQGLIEPLQQLQVPLIGICLGMQLLFEHSEEGDVDCLGMLPGIVRHMTPALGIRVPHMGWNQLVPMRDSALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQSGLRCGAQFHPERSADTGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.819 kDa

MRMKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAPQFHPEKSGKAGLAFLALARRYFEVL

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.27 kDa

MTDVALIDAGGANLGSVRYALERLGVDARLVRDAAGLQGAQRVILPGVGAAPEAMSRLRAQGLVEPLRELQVPLIGICLGMQLLFEHSEEGDVECLGLLPGIVRHMTPALGIRIPHMGWNQLVPMRDSALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQNGLRCGAQFHPERSAETGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.223 kDa

MTDVALIDAGGANLGSVRYALERLGVDARVVRDAAGLHGAQRVILPGVGAAPEAMSRLRTQGLVEPLRALQVPLIGICLGMQLLFEHSEEGDVECLGLLPGIVRHMTPALGIRVPHMGWNQLVPMRESALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQNGLRCGAQFHPERSADTGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.26 kDa

MTDLALIDAGGANLGSVRYALERLGVEARVVRDAQGLQGAERVILPGVGAAPEAMARLRAQGLIEPLQQLQVPLIGICLGMQLLFEHSEEGDVDCLGMLPGIVRHMTPALGIRVPHMGWNQLVPMRDSALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQSGLRCGAQFHPERSADTGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.26 kDa

MTDLALIDAGGANLGSVRYALERLGVEARVVRDAQGLQGAERVILPGVGAAPEAMARLRAQGLIEPLQQLQVPLIGICLGMQLLFEHSEEGDVDCLGMLPGIVRHMTPALGIRVPHMGWNQLVPMRDSALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAVVQSGLRCGAQFHPERSADTGARILRNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.249 kDa

MTDVALIDAGGANLGSVRYALERLGVEARVVRDAAGLQGAQRVILPGVGAAPEVMSRLRAQGLVAPLRELQVPLIGICLGMQLLFEHSEEGDVECLGLLPGIVRHMTPALGIRVPHMGWNRLVPMRESALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAIVQNGLRCGAQFHPERSADTGARILHNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.249 kDa

MTDVALIDAGGANLGSVRYALERLGVEARVVRDAAGLQGAQRVILPGVGAAPEVMSRLRAQGLVAPLRELQVPLIGICLGMQLLFEHSEEGDVECLGLLPGIVRHMTPALGIRVPHMGWNRLVPMRESALLAGLPERASAYFVHGYAAPVTADTVAACDHGGLFTAIVQNGLRCGAQFHPERSADTGARILHNFLEMSFP

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.275 kDa

MTEVALIDAGGANLGSVRYALQRLGVEPRLVCDARGLEGAARVILPGVGSAPEAMARLNNQGLIEPLLRLQVPLIGICLGMQLLFEHSEEGDVPCLALLPGRVRRLTPAPSIRVPHMGWNRLLPLRASPLLAEVPEGASAYFVHSYAVPLTTAAVAACDHGGMFTAIVQQGVRCGAQFHPERSAETGARILRNFLEMDAA

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.288 kDa

MTEVALIDAGGANLGSVRYALQRLGVEPRLVCDARGLEGAARVILPGVGSAPEAMARLNNQGLIEPLLRLQVPLIGICLGMQLLFEHSEEGDVPCLGLLPGRVRRLTPAPSIRVPHMGWNRLLPLRASPLLAEVPEGANAYFVHSYAVPLTTAAVAACDHGGMFTAIVQQGVRCGAQFHPERSAETGARILRNFLEMDAA

hisH

Imidazole glycerol phosphate synthase subunit HisH

200 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.013 kDa

MKVAIVEYGVGNLNSVYRAVKHLGHEPVVTDDPSELHDADAVILPGVGNFRAAAEKLEETGLCDEIRELLGSVPLLGICLGMQLLMESSEESPESRGLGVFRGTCVALPNDVKTPHMGWNTVEFRTEEFREFDGEMFYFVHSYRVAPEDDVVLGETEYGERFPSVIGDRGRLIYGMQFHPEKSGPVGLKLLGEVLTGASR

hisH

Imidazole glycerol phosphate synthase subunit HisH

199 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.036 kDa

MTNITIIDTGCANLSSVKFAFDRLGYNTEITFDLNKIKSADKLILPGVGTANAAMYNLQERQLIETIQNLTQPVLGICLGMQLMTEFSEEGNVPTLNLISGKTNRIPDTGLPLPQMGWNRVQFVKNCPLFDGIVQNSHFYFVHSYAVSPNEHSVAISNYGVNFSAAIAKENFYGVQFHPERSGKNGALLLKNFVEKVPF

hisH

Imidazole glycerol phosphate synthase subunit HisH

199 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.048 kDa

MINITIIDTGCANLSSVKFAFDRLGYNTEITFDLNKIKSADKLILPGVGTANAAMYNLQERQLIETIQNLTQPVLGICLGMQLMTEFSEEGNVPTLNLISGKTNRIPDTGLPLPQMGWNRVQFVKNCPLFDGIVQNSHFYFVHSYAVSPNEHSVAISNYGVNFSAAIAKENFYGVQFHPERSGKNGALLLKNFVEKVPF

hisH

Imidazole glycerol phosphate synthase subunit HisH

199 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.036 kDa

MTNITIIDTGCANLSSVKFAFDRLGYNTEITFDLNKIKSADKLILPGVGTANAAMYNLQERQLIETIQNLTQPVLGICLGMQLMTEFSEEGNVPTLNLISGKTNRIPDTGLPLPQMGWNRVQFVKNCPLFDGIVQNSHFYFVHSYAVSPNEHSVAISNYGVNFSAAIAKENFYGVQFHPERSGKNGALLLKNFVEKVPF

hisH

Imidazole glycerol phosphate synthase subunit HisH

199 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.048 kDa

MINITIIDTGCANLSSVKFAFDRLGYNTEITFDLNKIKSADKLILPGVGTANAAMYNLQERQLIETIQNLTQPVLGICLGMQLMTEFSEEGNVPTLNLISGKTNRIPDTGLPLPQMGWNRVQFVKNCPLFDGIVQNSHFYFVHSYAVSPNEHSVAISNYGVNFSAAIAKENFYGVQFHPERSGKNGALLLKNFVEKVPF

hisH

Imidazole glycerol phosphate synthase subunit HisH

199 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.533 kDa

MKALVINYGVGNLYSISSALKRVGFEVTIDNKPRNDYDLIVFPGVGAFSAVAEFILRYRELFNDLRRSGTNFLGVCLGMQIMFEKGTEGKESNGLGWFKGIVDKINANVKLPHIGWDLVFEVKDSCELTYGLDKKYVYYVHSYVAYPTSGDYVYMKSQYGIEYPALVCDKNVVGTQFHPEKSSNTGKIFLENLKGWIKR

hisH

Imidazole glycerol phosphate synthase subunit HisH

199 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.654 kDa

MTVVVDYEMGNLLSVTKALEELGYKPSVTSDPRKILEEDLVVLPGVGAFRDAVRNLKEKGLFLALKERASLNRPILGICLGMQLFFTKSYEDGEYEGLDLIPGEVVRFQKAPKIPHMGWNNLVPVDTTHELFKNLPDYYVYFVHSYYAQTDSRYVLAYTEYGEKFPAAVRRGSIIGFQFHPEKSGPVGRQILKNLREML

hisH

Imidazole glycerol phosphate synthase subunit HisH

198 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.532 kDa

MKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAPQFHPEKSGKAGLAFLALARRYFEVL

hisH

Imidazole glycerol phosphate synthase subunit HisH

198 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.532 kDa

MKALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEEADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFAPLTGRHFYFANSYYGPLTPYSLGKGEYEGTPFTALLAKENLLAPQFHPEKSGKAGLAFLALARRYFEVL

hisH

Imidazole glycerol phosphate synthase subunit HisH

198 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.988 kDa

MQNITIINTRCANLSSVKFAFDRLGYHTEITDNIEKIQSADKLILPGVGTAKAAMQNLADLGLIEVIQSLTQPVLGICLGMQLMTDYSEEGNLDLLKLMSGKTEKLPDCQLPLPHMGWNKVHYAADHPLFAEIAQDSYFYFVHSYGVLPNPHTVATCDYGVPFSAVIQHNNFYGAQFHPERSGKAGALFLRNFVENIK

hisH

Imidazole glycerol phosphate synthase subunit HisH

198 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.348 kDa

MIAIIDYGSGNLRSIANAFRKIGADALVTSDPQILEAADALVLPGVGAFGSAMAKLEGLRETLLGNIMDGKPFLGICLGLQVLLSESQESPGVHGLDLIPGRVIRIPPGNKVPHMGWNQLIIVEDSQLLEGAEDEYFYFVHSYYAEPSNDVVVARTDYGVEMTAAIESDNIHATQFHPEKSGEAGLDVLRNFVEIIRA

hisH

Imidazole glycerol phosphate synthase subunit HisH

197 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.064 kDa

MDIAILNTGCANLTSIQVAIKKLGYDSIVTSDPSIVLKSKKIFLPGVGTALAAMEQLHKKNLINTLKKLTQPILGICLGMQIFSQFSEECKGVKTIGIFDNCFTHLLKSSNLPLPHMGWNHIVFNNLHPLFKNIDKKERFYFVHSYIIPLNKYTLAKTKYGVSFSSVMQKNNFFGVQFHPEKSGDAGAQLLKNFLEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

197 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.686 kDa

MIAIVNYGVGNLKSISKALETVGAKVSVTSDPEKIKCASGVVFPGVGAFKSAIEKLNLIRDVIDSLEVPILGICLGMQLFATESTEGGVYRGLDYIPGRVVRFPPSVGKVPHMGWNTLKITREAEILDGVESGEFVYFVHSYYMQTDDEFVISKTDYGIDFPSGVERENYIGFQFHPEKSGKVGLRILENFVNIVKR

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.595 kDa

MNVVILGTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.653 kDa

MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.653 kDa

MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.731 kDa

MNVVIVDTECANLTSVRFAVERLGYSVLITDDAEQIRAADRVILPGVGTAAAAMRNLQRKQLVEPLRELTQPVLGICLGMQLLTSHSEEGDVDCLNLIPAKTKRLRDSGLPLPHMGWNTLQPTADNPLVDTSDSYCYFVHSFAVAVDEYTIASSEYGERFASMIRHNNYFGAQFHPERSGKTGEALLKRFLELTLC

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.731 kDa

MNVVIVDTECANLTSVRFAVERLGYSVLITDDAEQIRAADRVILPGVGTAAAAMRNLQRKQLVEPLRELTQPVLGICLGMQLLTSHSEEGDVDCLNLIPAKTKRLRDSGLPLPHMGWNTLQPTADNPLVDTSDSYCYFVHSFAVAVDEYTIASSEYGERFASMIRHNNYFGAQFHPERSGKTGEALLKRFLELTLC

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.302 kDa

MDVVILDTGCANLSSVTYAVQRLGYTPVISRDPAVVLRADKLFMPGVGTAHAAMEQLRQRELIELIKSCTQPVLGICLGMQLLATSSEESGGITTLGMIDAPVKKMTDFGLPLPHMGWNQITAQAGNHLFRGIPDGTYFYFVHGYAMPICPNTIAQTNYGEPFTAAVEKDNFFGVQFHPERSGAAGAQLMKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.302 kDa

MDVVILDTGCANLSSVTYAVQRLGYTPVISRDPAVVLRADKLFMPGVGTAHAAMEQLRQRELIELIKSCTQPVLGICLGMQLLATSSEESGGITTLGMIDAPVKKMTDFGLPLPHMGWNQITAQAGNHLFRGIPDGTYFYFVHGYAMPICPNTIAQTNYGEPFTAAVEKDNFFGVQFHPERSGAAGAQLMKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.265 kDa

MKVAVIKYNAGNIRSVDYALKRLGVEAVVTSDKEVLKAADKVIFPGVGEAETTMLHLKESGMDHFIKELRQPVLGICLGMQLMCRFSEEGNVDCLGIFDTDVKRFAPRKHEEKVPHMGWNTISCLKSDLFKGFTRDEFVYFVHSYYVPVSEFTAAETDYIRPFSAALHKDNFYATQFHPEKSGEAGERIIKNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.298 kDa

MKVAVIKYNAGNIRSVDYALKRLGVEAVITSDKEVLKAADKVIFPGVGEAETTMLHLKESGMDRFIKELRQPVLGICLGMQLMCRFSEEGNVDCLGIFDTDVKRFAPRKHEEKVPHMGWNTISCLKSDLFKGFTRDEFVYFVHSYYVPVSEFTAAETDYIRPFSAALHKDNFYATQFHPEKSGEAGERIIKNFLEL

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.134 kDa

MKVAVVKYNAGNIRSVDYALKRLGVEAVITADKEILQSADKVIFPGVGEAGTTMNHLKATGLDELIKNLRQPVFGICLGMQLMCRHSEEGEVDCLNIFDVDVKRFVPQKHEDKVPHMGWNTIGKTNSKLFEGFTEEEFVYFVHSFYVPVCDFTAAETDYIHPFSAALHKDNFYATQFHPEKSGKTGERVLRNFLDL

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.177 kDa

MKIIIINTNCSNLSSVKIMLNKLGCNTIITDDPDLIIQSDKILLPGVGTANTAMKQLKKKNLIQLIKKCTQPTLGICLGMQLFGSFSNENTHTNTLNIINVPVKHMYSPTLPIPHMGWNNITILKKHDLLNGINNNHYFYFAHSYCMELNYTTIAYTNYGQPFSSVIVYKNFFGVQFHPEKSSFSGEQLIKNFLEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.085 kDa

MNIVIIDTNCSNLLSVKTMLHRLGHNPIISDRADVISQADKLFLPGVGTASSAMKQLKKKNLITLIQNCTKPILGICLGMQLFGSISSENNGVNTLNIIHTPVKRMQYHGFPLPHMGWNTITIPKKHFLFYGIKENDYFYFAHSYCIKVCSVTISQTNYGQLFSSVIKYKNFFGVQFHPEKSGMPGQQLVKNFLEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.704 kDa

MNVVILDTGCANLSSVKSAVARHGYTPVVSREAEIVLRADKLFLPGVGTAQAAMDQLRERELIDLIKACTQPVLGICLGMQLLGRRSEETRGVDLLNIIEQDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFFGVQFHPERSGAAGAQLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.704 kDa

MNVVILDTGCANLSSVKSAVARHGYTPVVSREAEIVLRADKLFLPGVGTAQAAMDQLRERELIDLIKACTQPVLGICLGMQLLGRRSEETRGVDLLNIIEQDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFFGVQFHPERSGAAGAQLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.704 kDa

MNVVILDTGCANLSSVKSAVARHGYTPVVSREAEIVLRADKLFLPGVGTAQAAMDQLRERELIDLIKACTQPVLGICLGMQLLGRRSEETRGVDLLNIIEQDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFFGVQFHPERSGAAGAQLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.704 kDa

MNVVILDTGCANLSSVKSAVARHGYTPVVSREAEIVLRADKLFLPGVGTAQAAMDQLRERELIDLIKACTQPVLGICLGMQLLGRRSEETRGVDLLNIIEQDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFFGVQFHPERSGAAGAQLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.653 kDa

MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.653 kDa

MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.667 kDa

MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDIVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.653 kDa

MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

21.679 kDa

MYIVIVDTGCANLTSIKVAINNLGYNATITSESSIILKSNKIFLPGVGTASAVMDLLSKKKIINVIRECKQTILGICLGMQLFCASSEESNGVKTIGIIKTPALRLKVNNLSLPHIGWNQITFQKGHALFKNIPNNSRFYFVHSYMVPINKYTLSTTNYGINFSSIIQKDNFFGVQFHPEKSGNIGSQLLKNFLEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

22.202 kDa

MSIVIINTGCANLSSLKYAIQRLGYNVIITSNHKNILNAKKVFLPGVGTAFSAMKMLNQFKLKDVLYKYQQPVLGICLGMQLLCSFSSENNGIKMLDIIHAPVNILKSNKFPLPHNGWNNVSVCDENPLFIGIKNNSKFYFLHSYALYENDYMIAKTFYNVYFSAAVRKENFFGVQFHPEKSGLVGLQLLKNFLEI

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.295 kDa

MKVVILDTGCANLSSVTYAVQRLGYTPVVSREAEIVLQADKLFLPGVGTAQAAMNQLEERDLIALIKACTQPVLGICLGMQLLGTHSDESGGIPTLGIVDTPVKKMIDHGLPLPHMGWNQVIPKAGHRLFRDIDDGAYFYFVHSYAMPVCENTIAQANYGEAFTAALEKDNFFGVQFHPERSGAAGAQLLKNFLEM

hisH

Imidazole glycerol phosphate synthase subunit HisH

196 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

22.101 kDa

MIGIIDYNAGNLRSIQKAVELYDKVIITNNSEELLACDKIILPGVGNFGSAMENLAPLKETIYKIVDDRVPFLGICLGMQILFEESEEKRGIKGLGIIKGNVIKFKDVEKLPHMGWNSVKIVKDCPLFEGIKNNSYFYFVHSYHVNPDEDCIVGKTEYGREFPSVINKDNVFATQFHPEKSGKIGLKIIENFVELL

hisH

Imidazole glycerol phosphate synthase subunit HisH

195 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.29 kDa

MIAIVDYGVGNIANIERALKELGEAVIVTSDLELLGQAEALVLPGVGAYAPAMARLEETGLIEFLQEQATKKPFLGICLGMQLLFESSDEDGQTEGLGILPGTVEKLPSDVRLPHMGWHQLKNHGEAVYFVHSYGAVCDPDWIVDSVEYGRLVPAIVQKDLVTGMQFHPEKSGEVGLKLLKEWRETTCNSTQQSI

hisH

Imidazole glycerol phosphate synthase subunit HisH

195 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.323 kDa

MIAVVDLGIGNLANVRKALGGVITSDPYAIEGAEKIVLPGVGNFGAVMEKLEPLRGVIIDAINDGKPLLGICLGLQLLFEGSEESPGKPGLGVFRGNVVRFQGVRVPHIGWNQVWQRKECPLFEGIKDGAYFYFVHSYYALPEEDVTVGVTDYESKGAKVVFTSAVCRDNVYAVQFHPEKSGRNGLRLLENFRRL

hisH

Imidazole glycerol phosphate synthase subunit HisH

195 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.323 kDa

MIAVVDLGIGNLANVRKALGGVITSDPYAIEGAEKIVLPGVGNFGAVMEKLEPLRGVIIDAINDGKPLLGICLGLQLLFEGSEESPGKPGLGVFRGNVVRFQGVRVPHIGWNQVWQRKECPLFEGIKDGAYFYFVHSYYALPEEDVTVGVTDYESKGAKVVFTSAVCRDNVYAVQFHPEKSGRNGLRLLENFRRL

hisH

Imidazole glycerol phosphate synthase subunit HisH

194 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.66 kDa

MDRIAIVDLGIGNLANVKKALKGYITSDPYEIEKADKIVLPGVGNFGAVVDKLAPIKDIIIEGINEGKPFLGICLGMQLLFEESEESPGKEGLGIFKGKVVKLKNVRTPHIGWNQVWIKKECKLFEGLKNGSYFYFVHSYHAVPQDPDIIATTTDYENAEFVSSVCFENIFGVQFHPEKSSKNGLILLRNFRRL

hisH

Imidazole glycerol phosphate synthase subunit HisH

194 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.344 kDa

MIIIDTGCANLSSVKFAFDRLNIKAEISRDIATIKSADKLLLPGVGTAMAAMKILQDRNLIETIQNATQPMLGICLGMQLMTEYSSEGNVPTLSLMSGHTDLIPNTGLPLPHMGWNKVRYEQDHPLFAGIEQDSHFYFVHSYAVLPNEHTIATSDYGVPFSAALGCKNFYGVQFHPERSGKNGAQLLKNFVENL

hisH

Imidazole glycerol phosphate synthase subunit HisH

192 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.364 kDa

MIVIVDYGLGNISNVKRAIEHLGYEVVVSNKQNIIDQAETIILPGVGHFKDAMSEIKRLNLDAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGTDIPAIVQFNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND

hisH

Imidazole glycerol phosphate synthase subunit HisH

192 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

21.279 kDa

MIVIVDYGLGNISNVKRAIEHLGYEVVVSNTSKIIDQAETIILPGVGHFKDAMSEIKRLNLNAILAKNTDKKMIGICLGMQLMYEHSDEGDASGLGFIPGNISRIQTEYPVPHLGWNNLVSKHPMLNQDVYFVHSYQAPMSENVIAYAQYGADIPAIVQFNNYIGIQFHPEKSGTYGLQILRQAIQGGFIND

hisH

Imidazole glycerol phosphate synthase subunit HisH

192 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

20.826 kDa

METVALIDYGSGNLRSPAKALERAAAGCHASFQVLVTSDADAVRKADRVVLPAVGAFADCKRGLSEVPGMQLMAEGGREYGVTEGLGWIKGEVVKLEPADPTLKIPHMGWNELDIRREHPVLAGLRERAHAYFVHSYRFAVERPEDVIASADYGGPFAAVVGRDNLVGTQFHPEKSQETGLALVANFLTWRV

hisH

Imidazole glycerol phosphate synthase subunit HisH

190 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

20.917 kDa

MIVGVVDYTVGNIGSVLTALKRAGAVPVVVKGVEEAGRVDAVVLPGVGTYEAAYALARQFKEVVLEKPTLAICLGMQLLFESSEEGGGQGLGVFKGRVERIKARKVPNIGWRYTHVVKNSEIIAEGYYYYLHSYGVRWGENEAYTAYIKLEEKYVAAVERGHIIGVQFHPERSGRTGLELIKRFLAVAKR

hisH

Imidazole glycerol phosphate synthase subunit HisH

186 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF.

20.693 kDa

MIAIIDYGSGNLASVEKALHGVVTSDPYKIDMADKIVFPGAGSFSAAVSGIKNIRDIIIEKIRNGTPYLGICLGLEILFSESEEGPGTGLSFFNERLKRFKKGIHMGWNTVEFNDNIIFSGIKKGEYFYFVHRYYAPLGSYTCGKTFFNGYFTSFININNIYAVQFHPEKSGEPGLKLLRNFGELA

hisH

Imidazole glycerol phosphate synthase subunit HisH

175 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

19.54 kDa

single

MGKIIILNTDCANFTSIKSAIEKLGYCCMITAEPSIVKNAKKIILPGVGTALAAMNFLSQKKLVDIIKTFTNPILGICLGMQIFCNFSEESNGVKTIGVVKTSVLHLKTNNLPLPHIGWNQISFNKCHALFKDIPNNSRFYFVHSYIVPVNKYTLSVTNYGMNFSSVIQKNNFWR

hisH

Imidazole glycerol phosphate synthase subunit HisH

174 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

19.611 kDa

single

MSVVIINTGCANLSSVKYAIHRLGYNPVISTSRREILRSKKIFFPGVGTAHSAMHALKKLNLLNIIKDVQQPFLGICLGMQLLGSYSEESQGMHTLDIINFPVCALKSEKFPVPHNGWNNVEVCKNNILFNGIKNNSKFYFLHSYVVHVNEYTIAKTAYNICFSAAVNKDNFWR

hisH

Imidazole glycerol phosphate synthase subunit HisH

173 amino acids

IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the synthesis of IGP and AICAR. The resulting ammonia molecule is channeled to the active site of HisF (By similarity).

19.263 kDa

single

MSVVIINTGCSNLSSIKYAICRLGYNPKISTSVRDILSANKILLPGVGSAYSAIRVLSESNLLNIIKKCQQPFLGICLGMQLLSAFSSEAQGLDLLSIINSPVYRLNSGSLPLPHNGWNNVEICRNNVLFEDIENHSKFYFLHSYSVDITKYTIAKTLYNTYFSAAIQKNNFW