About Services Proteins Contact

hemA

Gene
hemA
Protein
5-aminolevulinate synthase, mitochondrial
Organism
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Length
648 amino acids
Function
Catalyzes the synthesis of 5-aminolevulinate (ALA) from succinyl-CoA and glycine, the first and rate-limiting step in heme biosynthesis.
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
68.96 kDa
Sequence
MEALLQQSRAMCPFLKRSSPNTLRSLATATRPSTSPGGGTMTNLQRIARRCPVMSKALAVQSARMTGTKRFTSSAAGVPGAGAGTPKPTRGSPGKRALHSTGGNGANMSTEFHKGAQQIHPGLSNATRSHVGASATVSGPTPRAPVAAPFDYDAFYNAELQKKHQDKSYRYFNNINRLAQEFPRAHTASKDEKVTVWCSNDYLGMGRNPEVLATMHKTLDTYGAGAGGTRNISGHNQHAVSLENTLAKLHGKEAALVFSSCFVANDATLATLGSKMPDCVILSDSLNHASMIQGIRHSGAKKMVFKHNDLVDLETKLASLPLHVPKIIAFESVYSMCGSIAPIEAICDLADKYGAITFLDEVHAVGMYGPHGAGVAEHLDYEIYASQDTANPLSTKGTVMDRINIITGTLGKAYGCVGGYIAGSAALVDTIRSLAPGFIFTTSLPPATMAGADTAIRYQARHQQDRILQQLHTRAVKQSFKDLDIPVIPNPSHIVPLLVGDAELAKQASDKLLEEHGIYVQAINYPTVPRGEERLRITPTPGHTQELRDHLVEAVNTVWNDLGIKRASDWKAMGGFVGVGVEAAELENQPIWTDAQLNMRPDETLEAAVEREFQAAVPGMKAGGAKAKPVGSIAANPIGASIPVAAAA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Length
581 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
60.562 kDa
Sequence
MSLLVVGLSHRSAPVSVLERASLNADAQLKLLQDTVAAEPAAEAAVLATCNRIELYADVDKFHAGVAELSTLLAQHSGVGLEELTPYLYVHYEDRAVHHLFSVACGLDSMVVGEGQILGQIKDSLARAQDLHTAGRLLNDLFQQALRVGKRAHSETGIDRAGQSLVTFGLEQLSAGADVEQWARGKKALVIGAGSMSSLAAATLARAGVAEIVVANRTFERAERLALLLEEQYGQRLSEGDDTDVLARAVPMDAVPGELTRADVAVSCTGATGLVLTADSVAATVEGRTGAPAVEDTAVQETAVREAGETPLPGAGSAADENCPLDLSSVSSVPSGFSVMGEAAVAGMDAATLEQHGAWAAGGTAVDRTREAGRSGPEADAELIGALAATATRVGRIPERRRPEPVAEAPRPQPVLFLLDLAMPRDVDAAVHRLAGVRLVDIESLADASADAPMAADVDMVRRIVADEVAAFGAAQRAAHITPTVVALRSMAADVVAGEIARLEGRLPGLDDKHRAEITQTVKRVVDKLLHAPTVRVKQLAAEPGGAGYADALRTLFDLDQETVASVSRAENSTEKNRGPA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Length
569 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
59.32 kDa
Sequence
MSLLVVGLSHRSAPVSVLERATLTADAQVKLLQDTVAAEPATEAAVLATCNRIELYADVDKFHAGVAELSTLLAQHSGVGLEELTPYLYVHYEDRAVHHLFSVACGLDSMVVGEGQILGQIKDALATAQELHTAGRLLNDLFQQALRTGKRAHSETGIDRAGQSLVTFGLEQLSAGTAVEAWAKGKRALVIGAGSMSSLAAATLARAGVAEVVIANRTPDRAERLAQILTEGDDTDVLARAVPMDAVPAELTRADVAVSCTGATGLVLTAEAVAAAVEGRTGTPVAVREETPASAAGGLAPAGTDEGCPLDLSAVQGATGFSVMGEAAVAGMDAATLEQHAAWVDRGTVDRRDSRRTPEVEAELITALAATVAAGGRLPERRRPEPVVEAPRPAPALALLDLAMPRDIDAAVHRLLGVRLVDIESLAEASADAPMAADVDLVRRIVADEVAAFGAAQRAAHITPTVVALRTMAADVVANEIARLDGRLPGLDEKQRGEITQTVRRVVDKLLHAPTVRVKQLAAEPGGAGYADALRTLFDLDPETVAAVSRADDRDTSDSTENAKNRGRE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sorangium cellulosum (strain So ce56)
Length
529 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
55.293 kDa
Sequence
MIFVGLSHKTAPIEVRERLAIGRDRLPEVLARLTAHPAIGEALVLSTCNRVEIYASPRQQAPAPPRPGSAPPPSDEELSRNNEALRAAVATLVGLGGDAVRGHLAGRVGSDAVLHLFRVAASLDSMVVGEPQILGQMKEAIEVARGAKTLGVRLGRAAHRAIKVGKRVRTETAIGAGQVSVSSVAIDLARQIFADLAGHTALLIGAGDMAEAASKLLVRAGARLIVVNRSPDRAAALAREVGGEPRPWADLERSVIDADIVISSTSSPNYVVTPDLVRRARKARKGRSLFLIDIAVPRDIDPAVNKLDSVYLYDVDDLSQIVAESVEGRAAEAARAEAIVADEAQAFEAWTLERALTPTIVGLRARTRSILVAEVERSLSGKLRHLGVAERQALAMMIDAATNKLLHVPTTRLRAMASDPRVAEHVDSLRELFDIDGAPPENAAASALAEGELRGAVDGPPTPRSARGAAPPASGARGGGSPRHADPRPQAAEDNGVYARQPGGRPAEAGVMAVANPAAAVSAAGLKGA

Gene
hemA
Protein
Probable multifunctional siroheme biosynthesis protein HemA
Organism
Clostridium josui
Length
515 amino acids
Function
Multifunctional enzyme that catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA), the NAD-dependent ring dehydrogenation of precorrin-2 to sirohydrochlorin and finally, the ferrochelation of sirohydrochlorin to yield siroheme.
Similarity
In the C-terminal section; belongs to the precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase family.
Mass
58.368 kDa
Sequence
MQLGRHNSGSIKKRLEMYILSIISASLDYKSAAIDIRERFSYTSTRIREILRRIKAADGVSGAVLLCTCNRTELYISGDNIENMNPALLLCQLSGEEDHKSLMTLFSIRHDSEAIFHLMEVACGLQSMVLFEDRVITQVKNAAAISREEKTIDSTLETLFRLCITAAKKAKTEIKVKAVPTSAAERAITELSKKYCFTDKRILVIGNGEIGRLCCKKLIELGAEITITLRKYKHGEIIIPVGCNTIPYDEREEVLPLSDVVISATTSPHFTITYDMIEKLERKPEIFVDLALPRDIESSISNFTGVELYNLDRFYTDYSVLNQKEVSKIREIINHFILQFEKWKDYREEAAFTKIPDLHNDTLYGRFPLFIDLSGKKVLVVGGGEIATRRVKTLLRFGADIYLVAPHLTSELQEMLNCKLINYREGYYESQDIQNMFLVIAATNDRETNHKVYLDAKEKGIQMSIADCREECSFYFPAIFEFDGIVGGLVSQNGDNHSLVKSVAEQIRKIGQATD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium jeikeium (strain K411)
Length
497 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
52.036 kDa
Sequence
MSGSTRTGSASVLLVGLSFRSAPVTMLEQATVADADLPKMQLSLVDNDVISESLVLSTCNRMEFYTVANAFHSGLDHVVDTIAQFSGLQTAELEPHLYVHYADSAAEHMLKVASGLDSMVIGEQQIIGQLRSAYQSANETGTVGRTLHDLTQRALRTGKRVHSETAIDSAGASMVSFALDQALRYIEPARALSAVVDDAPLSQPLAGHRALIIGAGAMASLASTHLGKLGIDHVTVANRTLSRAENLVNHARQAGVDASAVPLDGVTDCLSAVDIVVSATGAVGNVVTEQDVRAAVGAAGGVASVAGRRGTKVMIDLSMPADIEHSVAEIDGVKLLNIEELTTMAGDRVQDESPARAIVADELQSFLEQQRAQSVVPTVKALRQKAGEVMAEELMALERLTPDMSEADRAAVVKSMKRVVDKLLHTPTVQAKKLSAGGQQVSYPDALAALFNLPNGMVDSVTQPGQADSSAAQTAGTSARADQIPSAARVGRVVREA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Length
494 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
52.334 kDa
Sequence
MAGHVHTGSAAVLLVGLSFRSAPVSLLEQVSTVDTDLPKLENALLDHDSLSEALVLSTCNRMEFYTVANAFHPGLDHIVDTIATYSGLDDSELEPHLYVHYSDAAVEHMLNVASGLDSMVLGEQQIIGQLRGAYEESKGAGTVGRTLHDLTQRALRTGKRVHSETEIDSAGSSMVSFALDRALTVLGIPEASSDALSGRRAVVIGAGAMASLASTHLGRLGIEHVTVANRTVDRAEQLASHAVEAGVPARGIGLDELPAALTGADIVVSATGAVGTVVSAADIKAAQQVRDGRQQVLIDLSMPRDIEQATADVPGVALLNIEELTGMTEDTIEDEDAARGIVAEELESFLEQQRAQAVVPTVKALRQQAMDALSNEMLALQRQTPGMSDEDREAVNRSMRRLVEKLLHTPTVQAKKLSAAGQSVSYPDALAALFNLPTGMTQQVSAVKGANAGSGQRKKQKPQENRVSTARAVYRSTYQDLTQASTPGGKDDDQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Length
494 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
52.334 kDa
Sequence
MAGHVHTGSAAVLLVGLSFRSAPVSLLEQVSTVDTDLPKLENALLDHDSLSEALVLSTCNRMEFYTVANAFHPGLDHIVDTIATYSGLDDSELEPHLYVHYSDAAVEHMLNVASGLDSMVLGEQQIIGQLRGAYEESKGAGTVGRTLHDLTQRALRTGKRVHSETEIDSAGSSMVSFALDRALTVLGIPEASSDALSGRRAVVIGAGAMASLASTHLGRLGIEHVTVANRTVDRAEQLASHAVEAGVPARGIGLDELPAALTGADIVVSATGAVGTVVSAADIKAAQQVRDGRQQVLIDLSMPRDIEQATADVPGVALLNIEELTGMTEDTIEDEDAARGIVAEELESFLEQQRAQAVVPTVKALRQQAMDALSNEMLALQRQTPGMSDEDREAVNRSMRRLVEKLLHTPTVQAKKLSAAGQSVSYPDALAALFNLPTGMTQQVSAVKGANAGSGQRKKQKPQENRVSTARAVYRSTYQDLTQASTPGGKDDDQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salinibacter ruber (strain DSM 13855 / M31)
Length
479 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.933 kDa
Sequence
MRFYAVGLNHECTSLEQTETFALSAEEQEALYANLSLSADAEVVVLSTCNRTEAYLYGTEADLRQVKALIGQGGGTRWPEETAFQERDEAAVRHLLQVTSGLRSVVLGERQIFAQVKAAYERAVDAGGIHSVMHRLFHTAFRAAKRVSSETGLGRGAASVSTAAVEMARQDLSEAGGEGLRNTEIVLVGAGKMGRLALEALADESLASLTVVNRSPDRAREVASPFGGDTEPWADRHRAVATADLALVATGASDPVLHAPALPAPDEATLVVDVAMPRNVDPAVDERPGYRLYDLDDLEAWTAEVRERRADAVPEAESICEELLEDFVTWVFHQQALQPAIQAIRSTFDTIREQEVDRHAHRTGMDREEVDRLTESIMQKLLAVPIVRLKNVDPESIDFVQGIELLHALFAPSDESDAGRSLAEAPDADTPDLGEAPSRCPYMTHDPGGDGTETEEVQKALRLSAAHQAASHSEEVRGG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Rhodococcus jostii (strain RHA1)
Length
479 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.932 kDa
Sequence
MSVLLVGVSHRTAPVPVLERVAVTDTDRPKLTDKLLASSHISEAMIVSTCNRVEIYAVVDAFHGALAEVGELLADHSGLDLTDLHRHAYVRYSEAAAEHLFAVASGLDSMVIGEQQILGQIRTAYASSDAQQAAGRTLHELAQQALRVGKRVHSETGIDSAGASVVSVALDRAAGIVGDGGLTGRTAVVVGAGSMGGLSVAHLTRAGIGRIVVVNRTKERAEHLADTARANGVEAEALELSELPAAMAQADVLVTCTGAVGAVVTLADTHRALAQPGRDAERPLVICDLGLPRDVEPAVSGLPGVTVLDMESLQRDPAAGAAASDADAARTIVAAELANYLAGQRLAEVTPTVTALRQRAADVVEAELMRLDSRLPGLDDPERDEVARTVRRVVDKLLHAPTVRVKQLASAPGGDSYAAALRELFELSPGSVEAVAKPTDLGGATDLSAIDITDGFIAGQDPRLRRFVTDDNHGKESQA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Rhodococcus opacus (strain B4)
Length
478 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.79 kDa
Sequence
MSVLLVGVSHRTAPVPVLERVAVTDTDRPKLTDKLLASSHISEAMIVSTCNRVEIYAVVDAFHGALAEVGELLADHSGLDLTDLHRHAYVRYSEAAAEHLFAVASGLDSMVIGEQQILGQIRTAYASSDAQQAAGRTLHELAQQALRVGKRVHSETGIDSAGASVVSVALDRAAGIVGAGGLTGRTAVVVGAGSMGGLSVAHLTRAGIGRIVVVNRTRERAEHLADTARSNGVAAEALELAELPDAMAQADVLVTCTGAVGAVVTLADTHRALAQPGRDSERPLVICDLGLPRDVEPAVSGLPGVTVLDMESLQRDPAAGAAASDADAARTIVAAELANYLAGQRLAEVTPTVTALRQRAADVVEAELMRLDSRLPGLDDPERDEVARTVRRVVDKLLHAPTVRVKQLASAPGGDSYAAALRELFELSPGSVEAVAKPTELGGADLGAIDITDGFIAGQDPRLRRFVADDNRGKESQA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermobifida fusca (strain YX)
Length
477 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.977 kDa
Sequence
MSVLALGLSHRSAPVTLLERVALSGEVRLKLMTEMVNTSAVNEAMVVSTCNRTEVYADVDQFHPGVAAICELLSQYTGVSQEELTQHCYVHYEERAVQHLFSVACGLDSMVVGEGQILGQVRNALKDAQHVGTLGRVLNDLGQRALRVGKRAHTETHLDKAGASMVSFGLTVAGRFLTPDREPQPSAAAAVCPVDGDTGVEVSAALPDPQLLTGRRIMVLGAGSMSALAANTVARHGASTILIANRTFDRAQRLAECLTEGYESVRSSAVPFEDAARHLADIDLVISCTGAQGIVLTAEQVAAGGDRATRPLVFLDLALPHDIDKAVRKLPGVHLVDIEELRDAAEDGTATGQVADLTAVRDIVAEEVAEYQAVRSAERVAPTVVALRSKAQKVVESELERLNGRLPGIDDRTRAEITRTVRRVVDKLLHQPTVRVKQLATGPEGAVYAEALRELFDLDPAIPSAVVKPGTALGEER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Frankia sp. (strain EAN1pec)
Length
476 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.893 kDa
Sequence
MSLLAVGLNHRTAPTSLLELAAVSADDAPKVLHDLVGADHLSEAVLLSTCNRTEIYAEVETFHGGLADISDQLSRVCGVPLTDLASHLYVHHEARAVSHLFSVVCGLDSMLVGETQILGQVRAAFRLAQAAEVTSGTLANLFQTALRVGKRAHTETSIDAAGASIVSVGVRMAAFDLQARRPDMLVAPVASPGCDPGDAVEALLRPELTAPVEVAGPAPLAGARVLIIGAGAVGSLAAQTVRRAGAGDVVVANRTAARAARVADLHDARAVGLAEIAHEVGRADLVISSTGASGLVVGHDAVRASLAGRGARPLVFLDLALPRDIDPAVRELPGVTLIDIEALRVALDGAQVAHDVEAVRALVTTEVAGFLDRRRAERVAPTVVALRAHAAAVVRDELERLRTRLPDLDNREWDMVSGTVRRVVDKLLHAPTVRVQQLAEAPGGDSYAEALRELFDLPRDVPAIVSAPDLDLVERT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Acidothermus cellulolyticus (strain ATCC 43068 / 11B)
Length
473 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.72 kDa
Sequence
MSLLVVGVSHRGTPLSLLERAVLDSDQATKLLDDLVGSPVVREGMVLSTCNRVEIYACVEKFHPALTLISELLSRHGNVNFDEIAGHVHVHYDDRAVQHLFAVAAGLDSMLIGEHQVVGQVRDAFRLAQERGYAGRDLHAIVQDALHAARRVRAETRIDSAGQTLVDVGLQILSERLGPLAGRRALVIGAGAMASVAVAALTRVGITGLTVASRTLRRATALAQRYNGQAAALEKLADLLAETDVVVSCTGSVHPVVDAATLTKAVAGRTNPLGILDIALPHDVDPDVDRLPNVIRVDLETLRPVLENTASSADVRHARHILDEEFDAHVARRAAVGVVPTVVALRDKAARVVAAELRRLEKRLPELDPRQFEEIRTTVHRVVDKLLHAPTVRVQELAGLAGPDSYSEALRTLFDLDPAQPVAISAPQPSTDSPARAAYQPTDEAATDAEPRRDDAEPPSAAAAQDAGRESRP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3)
Length
473 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.915 kDa
Sequence
MSLLVVGLNHQTAPTSLLERTSVSAEDIPKVLHDLAEGTHVSEAVVLSTCNRIEIYAEVETFHGGVADISDQLSRICGIDLGDLAGHLYVHHEARAIGHLFSVVCGLDSMLVGESQILGQVRTAFRAGQAAGVAGSALSGLFQAALRVGKRAHSETSIDAAGASIVSVGVRLAASGLGLHSEVPAVPVAPPGGRALDGGGVAAEGPRHAVTPEPPPLAGTRVLLIGAGAVGSLAAQTVRRAGAGEVVIANRTAARAARVAEAHEARVVGLTDLAHEITMADLVISSTGASGLVVEHELVAAALPGRAGRPLVFLDLALPHDIDPGVRELPGVSLIDLDALRIALDGAQVTHDVEAVRALVAAEVASFLDRRRAGRVAPTVVALRAHAAAVVRSELARLHTRLPDLDDREWSLVEGSVRRVVDKLLHAPTVRVQELAGAPGGDAYAEALRELFDLPREVPAVVSAPDLDLLERS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium ulcerans (strain Agy99)
Length
473 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.215 kDa
Sequence
MSILLFGVSHRSAPVSVLEQLSIDESEQVKIVDRVLQSPLVTEAMVLSTCNRVEVYAVVEAFHGGLSAIGQVLSDHSGMSMGELTKHAYVRYSEAAVEHLFAVASGLDSAVVGEQQVLGQVRRSYSAAEANRTVGRVLHELAQRTLSVGKRVHSETSIDAAGASVVSVALGIAERKLGGLGAKTAVVIGAGSMGALSSAHLTRAGIGKVHVLNRSLARAQRLAGKIRQSGVLAEARTLDRLAEVLTDADAVVSCTGAVAPVVSLADVHHALATARRDETTRPLVICDLGMPRDVDPAVAGLPGVWLIDVERVQREPSAHAASADVAAARHIVAAEVAGYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPGLDSAERDEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFQLDQTAVDAVATAGELPVFSSGLDAGSGPQGADGPSAGPTPSAPNPSAE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Frankia alni (strain ACN14a)
Length
470 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.26 kDa
Sequence
MSLLVVGLNHRTAPTSLLEQASVSGDDTPKVLHDLAAAAHVNEAVVLSTCNRTEIYADVETFHGGVADISDQLSRISGIDLGDLAGHLYVHHDARAVGHLFSVVCGLDSMLVGESQILGQVRGAFRTGQSAGVAGSALSGLFQAALRVGKRAHSETSIDAAGASIVAVGIRLAASSLGILSEVPAVPVAPPGGVAGELGGAAVLAAPVAEPPPLAGARVLLIGAGAVGSLAAQTARRAGATEIVIANRTPARAARVAEMHDGRAVGLTDLPHEILMADLVISSTGATGLVVDHDLVAAALPGRGGRPLVFLDLALPHDIDPGVRALPGVSLIDLEALRVALDGAQVAHDVEAVRALVSTEVAGFLDRRRAGRVAPTVVALRAHADSVVHGELARLHSRLPDLDDREWELVEGAVRRVVDKLLHAPTVRVQQLAGAPGGDSYAEALRELFDLPREVPAVVSAPDLDLVERS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Length
468 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.361 kDa
Sequence
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Length
468 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.361 kDa
Sequence
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
Length
468 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.361 kDa
Sequence
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Length
468 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.954 kDa
Sequence
MNLLTVGLSHHSAPVRVLERVAIGADELGKVLHELLQRDHICEAFVVSTCNRVEVYAVAETFHGGLEDVTSVLARHSGSDVAELTDHMYVFYAGAAVEHLFSVAAGLDSMVVGEAQILGQIRQSYGVADEAGTVGRTLHELAQQALRVGKRVHAETGIDSEGASVVSEALADAETELGGLAGRRALLVGAGSMGGLAAAQLRRAGIGEVVIANRTAVNGERLAESLRTDGVPASAVALDGLRSAISWADLVVTCTGAVGAVVTTEHVETGDRGPLVFCDLGLPRDTAPEVAELPGVTVVDLATLQRRLSEQQGGNESERAAAIVAEEVRGYLAAQRSAEVTPTVTALRKRAAEVVDAELLRLDSKLPALEGDVRDELARTVRRVVDKLLHAPTVRVKQLASTPGGSGYADALRELFELDPQTAAVLGTAQADDGRARGSASVAEARRAGAPGARDELRDLPAQDGDDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Length
468 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.361 kDa
Sequence
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Length
468 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.361 kDa
Sequence
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Length
468 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.361 kDa
Sequence
MSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSLAGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDRLANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVARLPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAAEVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium leprae (strain TN)
Length
467 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.483 kDa
Sequence
MSILLFGVSHRSAPVSVLEQLSLDRSDQIKIVDRVLQSPLVTEAMVLSTCNRVEVYAVVEAFHAGLSVIGQVLSEYSAMSIGDLTKYAYVRYSEAAVEHLFTVASGLDSAVVGEQQVLGQVRRAYAAAEANRTVGQVLHEVAQRALSVGKRVHSETAIDAAGVSVVSVALGIAGRTLGGLAGRIAVVIGAGAMGALSSSYLTQANVGRIHVLNRSLSRARRLAGKIGESGVPADVWTLNHLDEALADADLVVSCTGAVSPVVSLADVHHALAAMRRDETTRPLVICDLGMPRDVDPAVAKLPGVWVVDVEGVQREPSARASAADVDAARRIVAAEVATYLTRQRMAEVAPTVTALRQRAADVVEAELLRLDHRLPGLESAQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYTEALRELFELDQTAVDAVATAGELPVMVSGFSDTTRYGTSPAQSSSKYHAE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Length
466 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.685 kDa
Sequence
MLVVGMSHRSAPVALLERLSMDDSVRGQTTSALVERPSLSEALIVSTCNRLEVYTVTSSFHTGVNDVVEVLHEISGVDIETLRGYLYVRYADAAAEHMLVVASGLDSMVVGEQQIIGQVRTAYQQATEAGTVGPALHALAQTALHTGKRVHTETDIDEAGASMVSFAIDRALTQMGIDPASDKPLAGKTALVLGAGAMSSLAATHLGREGVDKLIMANRTRERAERLASHSLEAGVPAEVVDFADRASVLDRVDMVVSATGADDFTVKPADIPAGVQLMLVDLSMPRDIDDACAEVPGVDLVNIERLHRAKREDPTGAAAEGADALAIVREELEAFTSEQRIRDVVPAVSALRKRANELLLDELDRLQARTPDISQEDWKEVTRTVRRVMDKFLHEPTVRVKKLAARSGSVSYESALQELFGLEAVQTTAPPAITSVNASDLPDAGIVAIVNSPSTTGQSVSVDGS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Psychrobacter cryohalolentis (strain K5)
Length
464 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.284 kDa
Sequence
MRLVVIGVNHKTAPVALRERLALVGDEVSIALAQLQGFSDGSVIVSTCNRTEIYALVPESILSPHTLLPNSASAVVETSVIESSMTANNSANLSSTIISAHILKIKTWLAGFKQLSLDEIDPYLYVHRNTHALTHWLRVAAGLDSMILGEPQILGQIKRAVHMAQDQKALSNQLGWIVDQVFAAAKRVRNETQVGAQAVSLSYAAAKLVTQIFDDLPSRTLLVVAAGEMNRLVATHIAGLGVGRVIICNRNPERAEALAAELRNPNRRIEVRTLQELPQVLAEADIVSSCSGSMDILIDKTMTLRALKSRRYQPMLMIDLAVPRDIDSTVSRIDDVYLYSVDDLQHVIAGNIEQRRQAAVDAELLVSQLVVEMDRRFQVRQVGKDIQQYRTRTHEQVNKLLQASIAELHGDSANPEDIMIELTRRLTQNLTHAPSKLMRKAAREGDNELLDFVVSGLQDAHRNH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium glutamicum (strain R)
Length
463 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.229 kDa
Sequence
MSVLIVGMSHRSAPVSLLERLSMDDSVRGETTQALLGRASLSEALIVSTCNRLEVYTVTSSFHTGVNDVVEVLHEASGVDIETLRGYLYVRYADAAAEHMLVVTSGLDSMVLGEQQIIGQVRTAYQAANEYGSVGPALHSLTQTALHTGKRVHSETAIDDAGASMVSFAVDRALVQMGLDSEAEAPLSGKTALVLGAGAMSSLAATHLGRAGISKLIMANRTLERAERLAEHSLEAGVPAEVVEYDQRASAYNRVDLVVSATGADDFTVKPEDIPEGASLMLVDLSMPRDIDDACADLPGVDLVNIERLHKASREGGSGMAPSEEEALAIVREELDSFTSEQRIRDIVPAVSALRRQAASVGSDELDRLRQRAPGISEVEWGEVEKTVRRVVDKLLHQPTVRVKELAARSGSISYDSALQELFGLESLASTAAPATTSVNASELPDAGIVAFVNAPSATQTRE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
Length
463 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.216 kDa
Sequence
MSVLIVGMSHRSAPVSLLERLSMDDSVRGETTQALLGRASLSEALIVSTCNRLEVYTVTSSFHTGVNDVVEVLHEASGVDIETLRGYLYVRYADAAAEHMLVVTSGLDSMVLGEQQIIGQVRTAYQAANEYGSVGPALHSLTQTALHTGKRVHSETAIDDAGASMVSFAVDRALVQMGLDSEAEAPLSGKTALVLGAGAMSSLAATHLGRAGISNLIMANRTLERAERLAEHSLEAGVPAEVVEYDQRASAYNRVDLVVSATGADDFTVKPEDIPEGASLMLVDLSMPRDIDDACADLPGVDLVNIERLHKASREGGSGMAPSEEEALAIVREELDSFTSEQRIRDIVPAVSALRRQAASVGSDELDRLRQRAPGISEVEWGEVEKTVRRVVDKLLHEPTVRVKELAARSGSISYDSALQELFGLESLASTAAPATTSVNASELPDAGIVAFVNAPSATQTRE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Length
461 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
52.306 kDa
Sequence
MCHIILLGMNHKTAPVEMRERLAVACRQEVNPLRLLPRLENVDELLFLSTCNRVEFLFTCRDRDGGLREVTALLRTYLGLDSTEGVENHVYAFRGMEAVRHVFRVASSLDSMVVGEPQILGQLKSAYREATEWRTVKVILNRLLHKTFSVAKRVRSETCIGSNAVSISYAAVELAKKIFGSLQDKRVLLIGAGEMAELAAEHLLAQGVRHMVVANRTLERAVDLAKRFRAETTPFDHILNALKNTDIVLSSTGAPEPILKYNDVRARMRERRNKPLFFIDIAVPRDIDPKINEIDNVYLYDIDDLQGVIDLNREERKREAERAEHIIAGETLKFQEWMATLNVVPTIVALREKAETIRRSELQRTLSHLPHMSEKDRLAVEALTEAIVKKLLHDPIVFLKKKADRSTKDMYVDYTQQLFNLADGDDGEEAPAVTVQMASAGNDGTLLKTFEPDKESPWRKS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Length
460 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.452 kDa
Sequence
MTEISSMVISHKKAKIEEMESAWHGDLDGLLNNLYHHEYVYECVVLKTCNRVEIYVVSPKSSSVLFSFAKEMGASTHIIDFYGHDESLEHLLRLAGGLESMIVGEDQILGQIKDLYAYSKKAGTTGKILDTAFEKAIQVGKRIRNETRINKGSVSIGSAAVDLAEDIFGGLTGKSVLVIGAGEIGVLVAKALAEKDIEAIYIANRTFKKAEEIAYELGGYAVRLDDIRGHLPDADVVISGTGAPHYILTREMIEEALDGRERKLLLIDIANPRDIEESVAELENVELCNIDNLRVISERTLKMRKEEAKKAEAIIQEEIRLLNIQYKRQKADRLISELYRQVYDVRVREREKAVNRLSAYHTIGEIETEVLDDLTHSIVNKILAEPTKVLRQAAELGNEEFLDVVSRVFCLEKDKAKLEKINQAKFEQIEPGCAKEQAAVKEQTAVKEQAVVKEQAAVKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium avium (strain 104)
Length
459 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.934 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSIDESDHGKIVDRVLQSPLVTEAMVLSTCNRVEVYAVVDAFHGGLAVIGQVLSDHSGMSMSDLTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYATAETNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALDMADRRLGGLAGKTAVLVGAGAMGALAAAHLSRAGIGQVHVLNRSLSRAQRLVRKIRETGVRADALPLEHLADALAGADVVVSCTGAVSPVVSLADVHHALAAAGRSAADETAHPLVICDLGMPRDVDPAVAGLPGVWVVDVDRVQHEPSAHAAAADVDAARTIVATEVAAYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPGLDSAHREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVAAGELPVIATGFDAGAPQQPTE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Length
459 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.934 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSIDESDHGKIVDRVLQSPLVTEAMVLSTCNRVEVYAVVDAFHGGLAVIGQVLSDHSGMSMSDLTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYATAETNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALDMADRRLGGLAGKTAVLVGAGAMGALAAAHLSRAGIGQVHVLNRSLSRAQRLVRKIRETGVRADALPLEHLADALAGADVVVSCTGAVSPVVSLADVHHALAAAGRSAADETAHPLVICDLGMPRDVDPAVAGLPGVWVVDVDRVQHEPSAHAAAADVDAARTIVATEVAAYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPGLDSAHREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVAAGELPVIATGFDAGAPQQPTE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Psychrobacter arcticus (strain DSM 17307 / 273-4)
Length
459 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.933 kDa
Sequence
MRLVVIGVNHKTAPVALRERLALVGDDVNIALAQLQGFSDGSVIVSTCNRTEIYALVPESILSPNTLLASSALSVVESSISLNSSTNISSTIISAHILKIKTWLADFKQLSLDEIDPYLYVHRDMHALTHWLRVAAGLDSMILGEPQILGQIKRAVHLAQDQKALSNQLGWIVDQVFAAAKRVRNETQVGAQAVSLSYAAAKLVTQIFDDLPSRTLLVVAAGEMNRLVAMHIAGLGVGRIIICNRNPERAEALAAELRNPKRQIEVRTLQELPQVLAEADIVSSCSGSMDILIDKTMTLRALKSRRYQPMLMIDLAVPRDIDSTVSRIDDVYLYSVDDLQHVIAGNIEQRRQAAVDAELLVSQLVVEMDRRFQVRQVGKDIQQYRSRTHEQVDKLLQESIAKLQGDNANPEDIMIELTRRLTQNLTHAPSKLMRKAAREGDNELLDFVVSGLQDAHRHH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Length
459 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
52.311 kDa
Sequence
MHILMIGLNYKTAPVEIREKFSFQDSELPQALHQLRQMKSILECTIVSTCNRTELYVVADQLHTGRHFTKTFLADWFKLPKDEFTPFLTIRENDHAIEHLFRVVTGLDSMILGETQILGQVRNSFFIAQEEQVTGSIFNHLFKQAITLAKRAHSETDIGQNAVSVSYAAVELGKKIFDDFKGKQVLILGAGKMGELTAKHLHSNGAEQVTVINRTREKAAELAKRFLGVDRPYNELTEAIVEADILISSTGATGYVVTSDMVSHALKKRKGRPLFMVDIAVPRDLDPALASHDDVYLYDIDDLQNIVQTNLEERRTEAEKIELLIEEELVEFKQWLNTLGVVPIITALRTKALTVQGETMESIERKLPNLTEREKKVLRKHTKSIVNQLLRDPITRIKELANAPEREEALDLFTKIFALEEELAEQEKQEKVKQAEQEWLAKKRPITCMEKQSHVMVKS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1)
Length
458 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.388 kDa
Sequence
MSVLVVGMSHQSAPVALLEKLSMDETVQNDTCRAMVSAGSLSEAMIISTCNRLEVYTVTNSFHSGVQDVVHNLAEVSGVEEEKLRSYLYVRYADAAAEHLMMVTSGLDSMVVGEQQIIGQVRTAYQFASEQGTVGPRIHALAQSALRTGKRVHSETEIDEAGSSMVSFAFDQALSRMGREDLAGKRVLILGAGAMASLAATHAGRLGAHLIIANRTIARAERVAQHAHEAGVYADVIDFSERAQALRDVDVAISATGAQGFTITAADVERYHVADRELMLVDLSLPRDIDDAVAEAEGVDLINIERLNNSLQAADTDLAAGTSPHAQARRIVSEELESYASEQRVRDVVPAVSALRKRAANLVQCEVARMEQKHPELDERQMGDINRALKRVADKLLHEPTVRAKQLAANSGTVSHETALQELFGLQLEGSGVAVDMAELPDAAQMEAAENTKEEKDA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Length
458 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.692 kDa
Sequence
MILAVIGINHETASVETREQLAFSSKQVKELVQKLIEGQPIKEASVLSTCNRTEVHFTVNTGQIEAGKNHIMTYLSDFSDLDPREYVDHLYFITDQEAVSHIFKVTAGLNSLVTGETEILGQVKKAYQLSDEAGGVDSIFHGLYQQALRTGKRVHRETGINDNAASVSYASVELATKIFGSLQNRRALIIGAGKMSELAARHLYSNGVKDVIVINRTIERAKNLADKFGGLYASYDQLSEWLNEIDIVITSTGAPHFVIKEEQIKRAMKSRKYSPMFLIDIAVPRDVEPSVNNQDNAYLYTIDDLEAVVESNMQERQEEARNAELIISEEVAEFMVWYKTRDVVPLISALREKAEDVRKMELEKYHKKLKNLSPKEQEAVDKLTKSIVNKILKEPVLRIKEFAVEDKSELYMATLAQLFDLEDEVIPKDGEEHSSSKEVESVTQSSTERGHHESDFHN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)
Length
456 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.085 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSVDDSDQAKLIDQVLQSSLVTEAMVLSTCNRVEIYAVVEAFHGGLSVIGQVLSEHSGMSLQDLTKHAYVRYAEAAVEHLFSVAGGLDSAVIGEQQVLGQVRRAYASAEANHTVGRTLHELSQRALAVGKRVHSETGIDAAGASVVSVALDTAEKKVGSLAGRSAVLVGAGSMGALAAKQLMRAGVERIHVVNRTLPRAAKLAENVRSYGITAEAFPFDHLPPLLTDADIVVTCTGAVRPVVSLADVHRGLAHVREPKELVICDLGMPRDVDPAVAGLPGVFVVDMERILREPTARAAATDADAARTIVAAEVAKYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPGLDAAHRDEVANTVRRVVDKLLHAPTVRVKQLAGAPGGDSYAEALRELFELDQHAVDAVAGTELGPLAGGDELGSLAIDLDMTE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium gilvum (strain PYR-GCK)
Length
455 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.012 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSTDESDQAKIIAEVLRSSLVTEAMVLSTCNRVEIYAVVEAFHGGLSVIGQVLSDHSGMSLQDLTKYAYVRYAEAAVEHLFAVASGLDSAVVGEQQVLGQVRRAYASAESNHTVGRTLHELSQRALAVGKRVHSETGIDRAGASVVSVALDVAEKKVGPLAGRSAVVVGAGSMGALAATQLARAGIERIHVVNRSLPRGKRLAENIRGYGIAAEAYPFDHLPPLLTDADIVVSCTGAVRPVVSLADVHRGLAHVREPKDLVICDLGMPRDVDAAVAGLPGVFVIDMDRILREPTAKTATSDADAARSIVATEVANYLAGQRVAEVTPTVTALRQRAADVVEAELLRLDNRLPGLDSSHRDEVANTVRRVVDKLLHAPTVRVKQLASAPGGDSYAEALRELFELDQHAVDAVAGSELGAVSGDELAAPAIDLDLTE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440)
Length
455 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.268 kDa
Sequence
MKLLVVGASYRTAPVAALERLTVAPADLSRVLTRLVAQPYVSEAVLVSTCNRVEVYAVVSGFHGGLGDICAVLAESTGCQPAALADHLYVHFDAAAVNHVFRVAVGLDSMVVGEAQILGQLRDAYHWASEAETVGRLLHELMQQALRVGKRAHSETGIDRAGQSVVTAALGLATELLHSDLACRPALVVGAGAMGSLGVATLARLGAGPVSVTNRGVDRAIRLAESYGATAVPIADLTATLSTVDIVVAATAAPEAVLTRAVVTQALAGRNPSRGPLVLLDLAVPRDVEPGVADLPGVQVIDIDRMAALVADGPVAADAAAVEQIVAAEVDTFLTWLRGADVAPTVAALRGRADDVVAAELGRLVHRRPDLTDEQRADVARTVHRVVQRLLHQPTVRVRQLAAEPGGDQYTALLRELFDLEVPQTSAVGTVPDVVVPDVDPQLGGDAEAPPTGGE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus pumilus (strain SAFR-032)
Length
455 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.817 kDa
Sequence
MHILVVGLDYKTAPVEIREQLSFEPSELGTAMSKLKEEKSILENIVISTCNRTEIYAVVDQLHTGRFYIKRFLADWFGLEKEDVSPYLKFYENDGAVEHLFRVACGLDSMVIGETQILGQVRSSFKVAQEEKTIGTVFNYLFKQAVTVAKRSHAETDIASNAVSVSYAAVELAKKIFGRLSDKHVLILGAGKMGELAAQNLQGQGIGQVTVINRTYEKAKELAGRFSGEPKSLNQLEKTLSEADILISSTGAKQFVITKEMVESANKKRKGRPLFMVDIAVPRDLDPAISEVEGAFLYDIDDLEGIVAANLKERRAVAEQVELLIEAEIVEFKQWLNTLGVVPVISALREKALTIQADTMQSIERKLPNLTHREMKLLNKHTKSIINQMLKDPILKAKEIAAEPNAEEKLLLFKEIFDLQVEDEEQKVEPVQVEQGSFQLFKPNMAQGFATVASE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus subtilis (strain 168)
Length
455 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.844 kDa
Sequence
MHILVVGVDYKSAPIEIREKVSFQPNELAEAMVQLKEEKSILENIIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLSKEELSPFLTFYESDAAVEHLFRVACGLDSMVIGETQILGQVRDSFKTAQQEKTIGTIFNELFKQAVTVGKRTHAETDIGSNAVSVSYAAVELAKKIFGNLSSKHILILGAGKMGELAAENLHGQGIGKVTVINRTYLKAKELADRFSGEARSLNQLESALAEADILISSTGASEFVVSKEMMENANKLRKGRPLFMVDIAVPRDLDPALNDLEGVFLYDIDDLEGIVEANMKERRETAEKVELLIEETIVEFKQWMNTLGVVPVISALREKALAIQSETMDSIERKLPHLSTREKKLLNKHTKSIINQMLRDPILKVKELAADADSEEKLALFMQIFDIEEAAGRQMMKTVESSQKVHSFKKAESKAGFSPLVSE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)
Length
455 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.798 kDa
Sequence
MHILVVGVDYKSAPIEIREKISFQPDELAEAMLRLKGEKSVLENIIVSTCNRTEIYAVVDQLHTGRYYIKTFLSEWFSLPKEELSPFLKFYESDAAIEHLFRVACGLDSMVIGETQILGQVRSSFKTAQAEKTIGTIFNELFKQAVTVGKRTHAETDIGANAVSVSYAAVELAKKIFGSLSNKHILILGAGKMGELAAENLHGQGIGKVTVINRTFLKAKALADRFSGEARSLNQLEHALAEADILISSTGASDFVVSKEMMERAGRQRKGRPLFMVDIAVPRDLDPALNDLEGVFLYDIDDLEGIVEANLQERRETAEKVELFIEAAIVEFKQWLNTLGVVPVISALREKALSIQSDTMQSIERKLPHLTVREKKLLSKHTKSIINQMLRDPILKAKELAAEADSEEKLKLFMQIFDIEEEAGRQLDKSLDNRQTVHSFQKAEAKTGLRPLVSE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacillus thermodenitrificans (strain NG80-2)
Length
455 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.772 kDa
Sequence
MQIIVVGVNYKTAPVEIREKLAFGEAELGEAMKQLAKQKSILENVIVSTCNRTEIYAVVDQLHTGRYYIKAFLAEWFDIEAEAIAPYLRVLEGEAAAGHLFRVAAGLDSMVLGETQILGQVKGSYLLAQEIGTSGTILNHLFKQAVTFAKRAHSETGIGAHAVSVSYAAVELAKKIFGHLNGKHVLIIGAGKMGTLAAQNLYGNGVGKVTVVNRTLEKAKQLAAQFDGEAKSLGELSCALLEADIVISSTGAKGYMLTKEEMAPLEKMRKGRPLFMVDIAVPRDLDPALAELETVFLYDIDDLQDVVAANLAERQKAAALIEEMIEGELVAFGQWLQTLGVVPVIAALREKALAIQAETMKSLERKLPHLSERDRKVLNKHTKSIINQLLRDPILQVKELAAGPNADEALQLFMKIFNIEDAVKAEQRSAQRAEVQLRDEQQAEAVRAARPSWQL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salinispora arenicola (strain CNS-205)
Length
455 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.087 kDa
Sequence
MKLLVVGASYRTAPVAALERLAVAPADLPHALARLVAQPYVSEAVLVSTCNRVEVYAAVSGFHGGLGDICAVLAESTGVPPAALADHLYVHFDAAAVKHAFRVATGLDSMVVGEAQILGQLRDAYHWASGADTTGRLLHELMQQALRVGKRAHSETGIDRAGQSVVTAALGLATELLNSDLAARPALVVGAGAMGSLGVATLSRLGAGPVAVTNRGADRAVRLAESYGATAVPIADLTATLSTVDIVVAATAAPEAVLTREVVTRALADRKPSRGPLVLLDLAVPRDVEPGVADLPGVQVIDIDRMAALVANGPAAADAAAVERIVATEVDAFLNWLRGADVAPTVAALRGRADNVVTVELGRLAQRRPDLTDDQRDEVARTVHRVVQRLLHQPTVRVRQLAAEPGGDQYAALLRELFDLEVPQTSPVGTVPEVVVPEAVPPLGGAAEDPSTGGQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacillus kaustophilus (strain HTA426)
Length
454 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.697 kDa
Sequence
MQIVVVGVDYKTAPVEIREKLAFAEAELGAAMKQLAKQKSVLENVIVSTCNRTEVYAVVDQLHTGRYYMKAFLAEWFGVKVEAIAPYLRVLEGEAAIKHLFRVAAGLDSMVLGETQILGQVKDSYLLAQEVGTSGTIFNHLFKQAVTFAKRAHSETGIGAHAVSVSYAAVELAKKIFGRLAGKHVLIIGAGKMGTLAAQNLYGSGVGKVTVVNRTLEKAKQLAKQFAGEAKPLGELSCALLEADIVISSTGAKGYILTKEMVAPLEKMRKGRPLFMVDIAVPRDLDPALADLETVFLYDIDDLQDVVAANLAERQKAAARIETMIEAELMAFSQWLQTLGVVPVIAALREKALAIQAETMKSLERKLPHLSERDWKVLNKHTKSIINQLLRDPILQAKELAAGPNAEEALLLFMKIFNIEDAVKAERHIEQAKSVQCDEQDAEAVRAARPSWQL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Lysinibacillus sphaericus (strain C3-41)
Length
454 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.925 kDa
Sequence
MHTIVVGLNYKTAPVEIREKLSFIESELPQAMEALQKQKSILENVIVSTCNRTEIYAVVDQLHTGRHFVKQFLADWFDLPVETFSSYLTIREEDEAVEHLFKVTAGIDSMVLGETQILGQVKKSFLSGQEIGTTGTVYNQLFKQAVTFAKRAHNETAIGENAVSVSYAAVELAKKIFGSLQRKHVAILGAGKMGELAIENLYGSGVGKVTVINRTFEKAESLAAKFHGQAKSMKELQCSLLEADILITSTGATDYVIDYELMQFVERLRKGKPLFMVDIAVPRDIDPRVGDLPNVFLYDIDDLQGIVEANLAERERAAADITDMIGHEVIQFKDWVSTLGVVPVISALRKKANRIQEETMTSIENKMPDLTERERKILSKHTKSIINQLLKEPILQAKEMANSPKANEQLRLFQQIFGIEEAVEAEVQEMTKQELERKERAQATQTSAEPKYSF

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus clausii (strain KSM-K16)
Length
454 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.518 kDa
Sequence
MHTIAIGLNYKTAPVEIREKLVFSEHQLPEALKKLRSSKSMMECVILSTCNRTELYVVADQLHTGRYFAKAFLAEWFSVDMEDVTPYLVIRENDHAIEHLFRVACGLDSMVIGETQILGQVKQAFLLAQEEKVTGTVFNQLFKQAVTLGKRVHSSTEISSQAVSVSYAGVELGKKIFGTFSGKHVLILGAGKMSELTAKHLYANGAASISVMNRTKENAVELASQFAGTARSFAELNDALKEADVVISSTGARDFVVTKENAADALKKRKGRPLFAIDIAVPRDIDPEIATISDVYLYDIDDLQNIVETNKKERKKEAEKIGVMIEAEIDDFKAWLNTLGVVPLITALREKALQIQGDTMESIERKLPHLSERDIKVLNKHTKSIVNQLLRDPLTRVKELAAEPDAKHSLELFKTIFALEAQIELAEKAEADHAEQSWKEGQRPSLNQGMALRT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Length
454 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.031 kDa
Sequence
MDILLLGLNYKTAPVEIREKFTFSDDGTARALHLLSQTKSIAECIILGTCNRTEIYVVCDQANIGRDYTRRFLAEWFGVEKEQFKDHLYIKENEQAIEHLFRVSSGLDSMVMGETQILGQVRDAFLLGQEHQTTGTVFNTLFKQAITFAKRAHTETAIGQNAVSVSYAAVELGKKIFGSFAGKSVLIVGAGKMSELTAKHLHANGSERVMVANRTLERAQLLAEKFKGDSCTMEQLPEALLTADIVISSTGATGYVLGKKELAPIMKQRKHRPLFMVDIAVPRDLNPDLHDLDNVFLYDIDDLEGIVASNVAERSREAERLDVMIQEEIVAFTTWYQTLGVAPLIAALRDKANTIQSEAMRKIENKLPNLSEREMHIIRKTTKGIVNQLLHDPVVRLKEMAATKDGEEVLDIFEKMFALEEILERKEQEAIWANDKNKQTSSSREQVLVSRFPD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Length
454 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.625 kDa
Sequence
MNTGVICGVRVSHNRASVEEIELAGERDSRTIMETLLTRDGITESFAIQTCNRSEAYVVADGAVAGRRALASFAPDVRDGAVVDMSHEESLRHLLRVATGLESLVLGEDQILGQFKRAIEVARGIGALGPMLEAGVTKAIHVGERARSETSINEGAVSIGSAAVRLAGQSVGLNGRKALVIGAGEMGSLVAESLASTNISEVVIANRTIENAESIAETINSPAYAVSLDSLTEVITEASIIMTATGYGKYLIEPTDIDGAGETFIIDLAQPRNVHPATADIENAIVQDIDALESITKETEASRQAAAREVDAMIDEEFDRLLESYKRQRADEAISEMYEAAEHVKRREVETALEKLEKQGTLTDNQRETISSMADTLINQLLAAPTKSLRDAAAEDDWTTIQTAMTLFDPNFGGDTPQPDRPDDIPRAAERGDISGDDLPDDVPNHIAEKVSDG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chloroflexus aggregans (strain MD-66 / DSM 9485)
Length
453 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.496 kDa
Sequence
MNLFLAGLDHTTAPVEIREQLAFSQTDLPSALLQLTQADNGSPPLFTEAVILSTCNRVEIYGVANPGTTAQHVVDFLANFHRRPAGSFVHTLYFYQGEAVARHLCATAAGLRSLVLGEAQIQGQVRSAYEAAQRIGSVGSVLHRLFQIALVAGKRVRHETTIGKGAASVSQAGVELARRRLGDLRGREVLLIGGGEVSELAAQNLIANGADRLTIVNRTSSRAAALAERYGAEMLDFGALPEALARADIVISSTAAPVPIIYRHHIAEALSHKQRMRACGDCDPPAMLLIDLAVPRDIAADVAELPGVYLFTVDDLREVVSHTIELRSAVIDIANQIVEEQVREFSDWLRTQEALPVLTMLRQRAEEVRNEELTRALRRLHDLSPEQRAVIEGLSRSIVNKLLHPPTRCLREAAAHGQGKRYATMLAELFNLEHALEHKAGAMGNTELTDRMR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Length
453 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.078 kDa
Sequence
MSVLLVGVSHRTAPVPVLERVAVTDTDRPKLIDKLLASSHISEAMIVSTCNRVEVYAVVDAFHGALTEVGEILADHSGLDLTALHAHAYVRYSEAAVEHLFAVASGLDSMVIGEQQILGQIRSAYASSDAQQAAGRVVHELAQQALRVGKRVHSETGIDSAGASVVSVALDRAAGIIGEGGLVGRTAVVVGAGSMGGLSVAHLTRAGIARIVVVNRTQERAEHLAETARSNGVDADGVAFDQLSAAMAQADVMVTCTGAVGAVVTLADVHRALAEPDRDNTKHLVICDLGLPRDIDPAVAGLPGVTVLDMETLQRDPAAGAAASDADAARTIVAGELATYLAGQRLAEVTPTVTALRQRAADVVEAELMRLDSRLPGLDDPQRDEVARTVRRVVDKLLHAPTVRVKQLASAPGGDSYAAALRELFELSPGSPAAVATPTDLVDGDRTGRDLQA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Length
453 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.54 kDa
Sequence
MHILVVGLDYKSAPVDIREKLTFQPDELGQAMAQLKEEKSILENIIVSTCNRTELYAVVDQLHTGRYYMKMFLANWFGLSKEDISPYLKFYENDGAVEHLFRVSCGLDSMVIGETQILGQVRTSFKLAQEEKTIGTVFNYLFKQAVTVAKRCHAETDIASNAVSVSYAAVELARKIFGDLSDKHVLILGAGKMGELAVQNLHGHGIGQVTVINRTFSKAKELAGRFSGAAKSLNELQCALMEADILISSTGASGYVVTKEMIEHVNKLRKGCPLFMVDIAVPRDLDPALSEVEGVFLYDIDDLEGIVEENLKERQAVAEEVELIIEAEIVSFKQWLNTLGVVPVISALREKALTIQAETMQSIERKLPHLSTREKKLLNKHTKSIINQLLRDPILKVKEFASEADAEEKLALFTQIFDIEEAAFPDGERQDERQPVHAFKRQNPQGLTSIASE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara)
Length
453 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.809 kDa
Sequence
MTVETGIVVGASVSHSHASIDQIETAADGSQQTAVEELLSKEGVSEAFVLQTCNRAEAYVVANDSETGTAALAGYLAGVDDDAIRMLSHNQSLKHLMAVACGLESLVIGEDQILGQVRDAYEDARGVGGVGPTLNDAVLKALHVGERARTETAINEGAVSLGSAAVRFAAERHGVTGSTALVVGAGEMATLAAKALDDPASRVIVANRTRERAERLAEELSTTASVVGVDSVDEAADAADVVVSATGSEDYVIDTADLGGVGETCVLDIAQPRDVAPGADGIDGVAVYDLDTIESVTDEARAKRREAAETVETMIDEEFEHLMTQYKRKRADQVIAAMYEGAERIKARELRTAVSKFEAEREDGLSEREHEIVESMADALVGQLLSAPTQSLRDAAEEDDWATINAALQLFGPGLEPEPTELPTVPDGPEGVPEELRERMSSGMLEQFSTNDD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Length
451 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.445 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSTNEAEQAKIIDQVLQSSLVTEAMVLSTCNRVEVYAVVEAFHGGLSVIGQVLAERSGMSLNDLTKYAYVRYAEAAVEHLFAVTSGLDSAVIGEQQVLGQVRRAYATAEANRTVGRTLHELAQRALSVGKRVHSETGIDAAGASVVSVALGMAETKLSGGLGGRTAAVVGAGAMGALAGAHLVRAGIERVHVVNRSLPRAERLAKNLTEQGVVADAVGLDDIARALVDADVVLSSTGAVRPVVSLADVHYALAQRTLAGAEHQMVVCDLGMPRDVDPAVSGLPGVWVVDMDRIQREPSARAAAVDAEAARNIVAAEVANYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPGLDAAHRDEVAKTVRRVVDKLLHAPTVRVKQLASAPGGDSYAEALRELFELDPQAVEAVAASELPLITTDLDKTE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Psychrobacter sp. (strain PRwf-1)
Length
451 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.055 kDa
Sequence
MNLVVIGVNHKTAPVALRERLAFVGGDIQVAQAQLQQITAGSLIISTCNRTEIYALAPSTQLLANSDAALSKQSDLSLADEPVSTVDLTEQLITWLADFKQVPLEETRPYLYDYVDGQALTHMLRVAAGLDSMILGEPQIFGQIKRSVNQAKEQGFLTNQLNWVVEQIFAAAKRVRNETDVGTQAISLGYAASKLVTQIFDRPEETTFLLIAAGEMNRLVAQNIAGLGVKRILICNRTPERANLLAQELAHLGIQIEVHPLTELDSLLYQADIVSSCSGSMDMLIDKAMTRRALKKRRYKPMLMVDLAVPRDIDSSVGKLDDVYLYSIDDLQHVIAGNLEKRRQAAVEAELLVSHLVVEIERRFQVRKVGQDIHDYRALAAQKAEAVLNEALHELRTSEATAEEVMTELTRRLTQTLVHAPSSLMRRAARDGNNEAIDLIILGLKDAYRKK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)
Length
450 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.363 kDa
Sequence
MTVFSLVASHHDLDLDTVARLSAGATGVGPALPGSGAAGAVVLATCNRVEIYAEADGAGVEAARAGLLSAVAASTSLPDEDVHAAFRTLDADATARHLFEVGVGLDSAVVGEREIAGQVRRALTAAQEAGTASGPLVRLFESATRTAKDVGSHTALGAAGRSVVSVALDLAEELRGLTDAAAQRDFWAGATILLIGTGAYAGTTLAQLADRGATTVGVHSASGRAEQFVADRGGWALALGGEAVAGAVAEADVIIGSSGGERQISPERLQELREGGRRPLTVVDLALSRDFDPAVADLPDVDLITLESVRLAAPEQAQVAVAEARALVDDAVEEYRAAQRGRSADAAIKALRRHTLGVLDRELERVRARHGCTAAAEEVEFALRRMVNQLLHEPSVRAKRLAAEGRLDRYEDALEAVFGIEAPGRPASEVGTVEAACPAHEDEGGAARIA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.498 kDa
Sequence
MYLVVVGVNHRTAPVEVREKLSFSDHQLKDAFSALLSYPSIDGSVILSTCNRTEVYVASLDVDTGLKVVREFLANWAGLSLSDIKNYTYNYTLYDAVHHLFRVASGLDSMILGETQILGQVRDAFLKASSLKASNKILNTLFQHAITVGKKVRTETGIDKNPVSISYAAVQLACSFFGSLKDKKALLIGAGKMSSLTAKHLSYYGIKEIIVANRSFEKAEQFAREFNGIAVPFAKIYDILAEVDLVISCTGAPHLIIHKEQLELVIGNRQHPLYLIDIAVPRDIDPEIAKLPNVFLYDIDKLQNVVTKNLEERKKLAEMAENIIETELKAFIEWHSTQFVVPTIVALKKKAEEIKQKELTKALNKLGNISEREKNIVCALAHTILNQLLHTPIVKLKQYALTPQGHLYTEILQNLFDLQVEGERPKNFTHPREEMEESDEKRSYCGESR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter pylori (strain HPAG1)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.652 kDa
Sequence
MELETHLSKYFTLAFTHKSMSLEMREKLAINSSATLKEFLQTIKNHCPNIKECMVLSTCNRFEIYASLRHGAHANEQKSALLKILAQNKKMSVSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKCAAKVRNLTGISKQGVSISSVAVKEALNIFEKERIKDKKALVIGLGEMAQLVIKHLLNKQFEALILGRNAAKFEDFIKELEEPKKVSFQNIENLNAYINEYELLFCATSSPHFIVQNSMLKETIFRRFWFDLAVPRNIEKPVLDNIFLYSVDDLEPMVKENVGNRQESRTKAYEIVGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKALKKRYVPKEYESNIEKILHNAFNTFLHHPTIALKKNAQKEESDVLVGAIKNLFNLDKSNANHAQNLNLYKCEYYEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter pylori (strain J99 / ATCC 700824)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.613 kDa
Sequence
MELETHLSKYFTLAFTHKSMSLEMREKLAINSPIMLKELLQTIKTHCPNIKECMVLSTCNRFEIYASLKHGANTHEQKSALLKILAQNKKMSVSDLEKCVLINTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKCAAKVRNLTGISKQGVSISSVAVKEALSIFEKERIKDKKALVIGLGEMAQLVIKHLLNKQFEVLILGRNAAKFEDFVKELEEPKKVGFQNVENLNAYINEYELLFCATSSPNFIVRNSMLKETIFRRFWFDLAVPRNIEKPTLNHIFLYSVDDLEPMVKENVGNRQESRTKAYEIVGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKALKKRYVPKEYEGNIEKILHNAFNTFLHHPTIALKKNAQKEESDVLVGAIKNLFNLDKSNANHAQNLNLYKCEYYEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter pylori (strain Shi470)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.723 kDa
Sequence
MELETHLSKYFTLAFTHKSMGLEMREKLAINSSATLKEFLQTIKNHCPNIKECMVLSTCNRFEIYASLKHGAHANEQKSALLKILAQNKKMSVSDLEKCVLMSVDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKCAAKVRNLTGISKQGVSISSVAVKEALNIFEKERIKDKKALVIGLGEMAQLVIKHLLNKQFEALILGRNEAKFEDFIKELEEPKKVSFQNIENLNAYINEYQLLFCATSSPHFIVQNDMLKETIFRRFWFDLAVPRNIEKPVLDNIFLYSVDDLEPMVRENVENRQESRTKAYEIVGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKALKKRYVPKEYESNIEKILHNAFNTFLHHPTIALKKNAQKEESDVLVGAIKNLFNLDKSSANHAQNLNLYKCEYYEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter pylori (strain ATCC 700392 / 26695)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.902 kDa
Sequence
MELETHLSKYFTLAFTHKSMSLEMREKLAINSNATLKEFLQTIKNHCPNIKECMVLSTCNRFEIYASLKHGANTNEQKNALLKILAQNKKMSVSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKCAAKVRNLTGISKQGVSISSVAVKEALNIFEKERIKDKKALVIGLGEMAQLVIKHLLNKQFEALILGRNAAKFEDFIKELEEPKKVSFQNIENLNAYINEYELLFCATSSPHFIVQNRMLKETIFRRFWFDLAVPRNIEKPVLDNIFLYSVDDLEPMVRENVENRQESRMRAYEIVGLATMEFYQWIQSLEVEPVIKDLRELARISAQKELQKALKKRYVPKEYENNIEKILHNAFNTFLHNPTIALKKNAQKEESDVLVGAIKNLFNLDKSNANHAQNLNLYKCEYYEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanosarcina barkeri (strain Fusaro / DSM 804)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.081 kDa
Sequence
MTEISSMVISHKKAKIEEMESAWHGDLDGLLHNLYNHEYIHECVVLKTCNRVEIYVVSPSSSILFSFAKEMGASTHIIDFYGHDESLEHLLRLAGGLESMIVGEDQILGQIKELYAYSKKAGTTGKILDTAFDKAIQVGKRIRNETRINKGSVSIGSAAVDLAEEILDGLAGKSVLVIGAGEIGVLVAKALAAKDIEAIYIANRTFKKAEELAYELGGYAVKLNDVQTQLKNADVVISGTGAPHYILTREIVEKAIEERDKTRKLLLIDIANPRDIEESVAELDNVKLCNIDNLRVISEKTLKMRKEEAKKAEAIIQEEIKLLNLQYKRQRADKIISDLYKQIYDVRIREREKAVNRLCAYHTIGKIETDVLDDLTHSIANKILAEPTKVLRQAAELGNDEFLDVAARIFCLEKDKVKAEKIKSDCGIKVEKMKPDCESATDRVSEKGN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Halorhodospira halophila (strain DSM 244 / SL1)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.15 kDa
Sequence
MPLFAIGLNHDSAPVAVRESLAFNAEALGDALQSARSETGADEVAILSTCNRTEIYIRLPHTDPEVVIGWLTRHQRVDLRKVRPHLYVRRSTEAMRHLMRVSAGLDSLVLGEPQILGQVKDAYHKAANAGCLGAVLERLFQHAFAVAKQVRTDTDIGSNPISVAFAAVTMAKQIFDDFPKRTAVLVGAGETIELVARHLGQQGIGQVLVANRNVERAKRLAEAHDGEAMSLNDLPRRLPEADVVVSSTGSSLPILGKGTVERAVRARRHKPMFMLDLAVPRDIEPEAGEMDDVYLYTVDDLRGVVAENMRSRQDAATQAEAIVEQQVRHYLEWRRARDAGEAIRSFRSRAESYARATRAQAARQLSRGEDPFEVIEWLTHTLTRRLVHAPTVGLRAAAATGDRTRIQHALETLAIDQQLVERSSEGDDSQQAGADGGAARGDRRAAGGS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter pylori (strain P12)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.85 kDa
Sequence
MELETHLSKYFTLAFTHKSMSLEMREKLAINSSTTLKEFLQTIKTHCPNIKECMVLSTCNRFEIYASLKHGANTNEQKNALLKILAQNKKMSVSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKCAAKVRNLTGISKQGVSISSVAVKEALNIFEKERIKDKKALVIGLGEMAQLVIKHLLNKQFEVLILGRNAAKFEDFVKELEEPKKVSFQNIENLNAYINEYELLFCATSSPHFIVQNRMLKETIFRRFWFDLAVPRNIEKPVLDNIFLYSVDDLEPMVRENVENRQESRTKAYEIVGLATMEFYQWIQSLEVEPVIKDLRELARISAQKELQKALKKRYVPKEYESNIEKILHNAFNTFLHHPTIALKKNAQKEESDVLVGAIKNLFNLDKSTTCHAQNLNLYKCEYYEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter pylori (strain G27)
Length
449 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.805 kDa
Sequence
MELETHLSKYFTLAFTHKSMSLEMREKLAINSSATLKEFLQTIKTHCPNIKECMVLSTCNRFEIYASLKHNTHANEQKNALLKILAQNKKMSMSDLEKCVLMNTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYRFAFEEKFCSKDLTRLLHFAFKCAAKVRNLTGISKQGVSISSVAVKEALNIFEKERIKDKKALVIGLGEMAQLVIKHLLNKQFEVLILGRNAAKFEDFIKELEEPKKVSFQNIENLNAYINAYALLFCATSSPHFIVQNRMLKETSFRRFWFDLAVPRNIEKPVFNNIFLYSVDDLEPMVRENVGNRQESRTRAYEIVGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKALKKRYVPKEYEGNIEKILHNAFNTFLHHPTIALKKNAQKEESDVLVGAIKNLFNLDKSTTCHAQNLNLYKCEYYEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus haemolyticus (strain JCSC1435)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.307 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRLAHEDLFETKSILENVILSTCNRTEVYAIVDQIHTGRYYIQRFLARSFGFDVDDIKNMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQMRDAFFLAQDIQTTGTIFNHLFKQAITFAKKAHNETDIADNAVSVSYAAVELAKKVFGKLKGKQTIIIGAGEMSELSLLNLLGSGIDDITVVNRTETNAYKLATKHGVNYNTLESLPTLLTNADIVISSTSSPDFIVTKSMIESVNLKRKASSLLLIDIAVPRDIEPNVNISENIFSYDVDDLKGLVDANLRERQMAADFIASQIPDEVQAHNDWVNMLGVVPVIRALREKAMTIQSETMDSIDRKLPDLSDRERTIISKHTKSIINQMLKDPIKQAKELSNDKRSNEKLELFQNIFDIDAADPYEDIKAHKAQKEKEVSIRHIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.912 kDa
Sequence
MHIVVVGLNNKTAPVAIREQFSFGEQEIVDAMIALREEKSIFESVILSTCNRTELYVVTDQLHTGRYYTKRFLANWFNLEMEQFTPYLSIREGEEAIRHLFRVTSGLDSMIIGETQILGQVKTSFFRAQEHGTTGTVFNKLFKEAVTLAKRAHTDTQIGEMSVSVSSAAVTLAQEMYQQLEDKQVVVVGAGETGELTTLNLFEAGAKQIAVFNRTESKAKAVADKFKGRAHSIREIACGLLDADILISSTGAKEAVIGYDDVAAAQLLRRERPLLLIDIAVPRDIDPAVATLPGVHLFDVDDLNGIVNKNLEARLVEAEKIEMKIDEAIQEFQTWLVTLGVVPIMNELRARALDIQEDTMTSLERKLDHLSARDKKVIGKHMKSIINQMLRDPIDYIKDAAAQPDANVRIAQFIETFGLDVELPEQPVDEVEETDATSAKAPLRALMR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.562 kDa
Sequence
MTEISSMVISHKKAKVEEMESAWHGDLDGLLRNLYKHEYVYECVVLKTCNRVEIYVVSPKSSSVLFSFAKEMGASTHIIDFYGHDESLEHLLRLAGGLESMIVGEDQILGQIKDLYAYSKKAGTTGKILETAFEKAIQVGKRIRNETRINKGSVSIGSAAVDLAEDIFGGLTGKNVLVIGAGEIGVLVAKALAEKDIEAIYIANRTYKKAEEIAYELGGHAVRLDDIRDYLPGADVVISGTGAPHYILTREIVEEAIKCRERKLLLIDIANPRDIEESVVELENVELCNIDNLRVISERTLRMRKEEAKKAEAIIQEEIRLLNLQYKRQKADRLISELYKQVYDVRLRERQKAVNRLSSYHTIGDIETEVLDDLTRSIVNKILGEPTKVLRQAAELGNEEFLDVVSRVFCLDKEKVRFEKIKQAKFDQIKPGCTKEQAEVKEEYAVKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain Mu3 / ATCC 700698)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain JH1)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain USA300)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain NCTC 8325)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.159 kDa
Sequence
MHFIAISINHRTADVALREQVTFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPTEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain JH9)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.06 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGCYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQTYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain COL)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain Newman)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain N315)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain MRSA252)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.118 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWVSMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKFELFQNIFDIEAKCPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain MSSA476)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain USA300 / TCH1516)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus aureus (strain MW2)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.099 kDa
Sequence
MHFIAISINHRTADVALREQVAFRDDALRIAHEDLYETKSILENVILSTCNRTEVYAVVDQIHTGRYYIQRFLARAFGFEVDDIKAMSEVKVGDEAVEHLLRVTSGLDSIVLGETQILGQIRDAFFLAQSTGTTGTIFNHLFKQAITFAKRAHNETDIADNAVSVSYAAVELAKKVFGKLKSKQAIIIGAGEMSELSLLNLLGSGITDITVVNRTIENAMKLAAKHQVKYDELSSLPNLLESADIVISSTSAQSYIITNEMIERIAENRKQDSLVLIDIAVPRDIEPGISAITNIFNYDVDDLKGLVDANLRERQLAAATISEQIPAEIHAHNEWISMLGVVPVIRALREKAMAIQAETMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQNIFDIEAECPHEQAKQQKESKVKEISARRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.152 kDa
Sequence
MHFVAISINHRTADVTLREQVAFRDDALRLAHEDLYETKAILENVILSTCNRTEVYAIVDQVHTGRYYIQRFLARSFGFEVDDIKDMSEVKVGDDAVEHLLRVTSGLDSIVLGETQILGQMRDAFFLAQNTGTTGTIFNHLFKQAITFAKKAHSETDIADNAVSVSYAAVELAKKVFGKLKSKHAVVIGAGEMGELSLLNLLGSGISNVTIVNRTLSKAKILAEKHNVSYDSLSALPSLLETTDIVISSTSAEDYIITNSMVKTISETRKLDSLVLIDIAVPRDIEPGIDAITNIFNYDVDDLKDLVDANLRERQLAAETIAGQIPEEIDSHNEWVNMLGVVPVIRALREKAMNIQAETMESIDRKLPDLSERERKVISKHTKSIINQMLKDPIKQAKELSTDKKSNEKLELFQNIFDIEAEDPREKAKLEKESRAKEILAHRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus epidermidis (strain ATCC 12228)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.151 kDa
Sequence
MHFVAISINHRTADVTLREQVAFRDDALRLAHEDLYETKAILENVILSTCNRTEVYAIVDQVHTGRYYIQRFLARSFGFEVDDIKDMSQVKVGDDAVEHLLRVTSGLDSIVLGETQILGQMRDAFFLAQNTGTTGTIFNHLFKQAITFAKKAHSETDIADNAVSVSYAAVELAKKVFGKLKSKHAVVIGAGEMGELSLLNLLGSGISNVTIVNRTLSKAKILAEKHNVSYDSLSALPSLLETTDIVISSTSAEDYIITNSMVKTISETRKLDSLVLIDIAVPRDIEPGIDAITNIFNYDVDDLKDLVDANLRERQLAAETIAGQIPEEIDSHNEWVNMLGVVPVIRALREKAMNIQAETMESIDRKLPDLSERERKVISKHTKSIINQMLKDPIKQAKELSTDKKSNEKLELFQNIFDIEAEDPREKAKLEKESRAKEILAHRIFSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Length
448 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.712 kDa
Sequence
MRGDTGAIVGVCISHERASVDQLETAAADSERHAVESLLANPAVEEAIALQTCNRTEGYVVVSDHEDGLEALELFTRAVPDDVVVEMGHEESLRHLLRVAAGLESIVLGEDQILGQLRTAYETARGVGGIGPMLEDGVTKAIHVGERARTETKINEGVVSIASAAVRLLKQESSLTDGTALVVGAGEMGQLAAEALSEEVDRLLVANRTVPHAEHIAESVDIDASALALDGIEAAVSEASAVISATGSGDQVFDIGTFSDSGDVSIVDIAQPRDVPAGADRLPSVTVYDLDALESVTAETRNKRQRAAEAVERIVDEEFDRLLTQYKRKRADRVISTMYESAEQVKAAEINSALSAADFDDEQAEVVEAMADAIVSQILAAPTKSLRDAAEEDDWSTIHTALQLFDPDFGGPDQATPPEFTKGMSVEDIPDGMRDEIPNAMLDRLSDD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Tropheryma whipplei (strain TW08/27)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.838 kDa
Sequence
MLLCVSANHKKTSFTVLEQLARVSPDFASELVEAEDIDGAAILSTCNRFEVYIDAIQKGDQDDVCKTGLLVQNRIGELCNISPSTIIEQTSFLAGCEVSRHLFSVATGLESMIIGETEIAGQVKRALTYAQKCRTTSPELERLFQRASAVNRHIRQSTKINEVGQSLVSLSLDLASSRIGDWSGVRAIIVGTGKYASKALALLKERGVVDISVYSPSGHVNNICNTEGVRNIFNLQTALSGCDLVVGCSSVDKPVITKQDIETAQASGSRTSRVRPVGRPSTDLTAIEASNRSRHVLIDLGLPRNFDPAISDLPTADLIDLDMLRVHAPFDNLAAEKMAHELAIESSSQFVNDCKQHEATPVIVSFRNYLESLTQTSLRRTDNCKHAQHALKHFVNSLIHIPLTRCKQLAANGESHKFAESMEILFDVKTDCTEGTQYQSSCGKSFD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Tropheryma whipplei (strain Twist)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.838 kDa
Sequence
MLLCVSANHKKTSFTVLEQLARVSPDFASELVEAEDIDGAAILSTCNRFEVYIDAIQKGDQDDVCKTGLLVQNRIGELCNISPSTIIEQTSFLAGCEVSRHLFSVATGLESMIIGETEIAGQVKRALTYAQKCRTTSPELERLFQRASAVNRHIRQSTKINEVGQSLVSLSLDLASSRIGDWSGVRAIIVGTGKYASKALALLKERGVVDISVYSPSGHVNNICNTEGVRNIFNLQTALSGCDLVVGCSSVDKPVITKQDIETAQASGSRTSRVRPVGRPSTDLTAIEASNRSRHVLIDLGLPRNFDPAISDLPTADLIDLDMLRVHAPFDNLAAEKMAHELAIESSSQFVNDCKQHEATPVIVSFRNYLESLTQTSLRRTDNCKHAQHALKHFVNSLIHIPLTRCKQLAANGESHKFAESMEILFDVKTDCTEGTQYQSSCGKSFD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Tropheryma whipplei (strain TW08/27)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.838 kDa
Sequence
MLLCVSANHKKTSFTVLEQLARVSPDFASELVEAEDIDGAAILSTCNRFEVYIDAIQKGDQDDVCKTGLLVQNRIGELCNISPSTIIEQTSFLAGCEVSRHLFSVATGLESMIIGETEIAGQVKRALTYAQKCRTTSPELERLFQRASAVNRHIRQSTKINEVGQSLVSLSLDLASSRIGDWSGVRAIIVGTGKYASKALALLKERGVVDISVYSPSGHVNNICNTEGVRNIFNLQTALSGCDLVVGCSSVDKPVITKQDIETAQASGSRTSRVRPVGRPSTDLTAIEASNRSRHVLIDLGLPRNFDPAISDLPTADLIDLDMLRVHAPFDNLAAEKMAHELAIESSSQFVNDCKQHEATPVIVSFRNYLESLTQTSLRRTDNCKHAQHALKHFVNSLIHIPLTRCKQLAANGESHKFAESMEILFDVKTDCTEGTQYQSSCGKSFD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Tropheryma whipplei (strain Twist)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.838 kDa
Sequence
MLLCVSANHKKTSFTVLEQLARVSPDFASELVEAEDIDGAAILSTCNRFEVYIDAIQKGDQDDVCKTGLLVQNRIGELCNISPSTIIEQTSFLAGCEVSRHLFSVATGLESMIIGETEIAGQVKRALTYAQKCRTTSPELERLFQRASAVNRHIRQSTKINEVGQSLVSLSLDLASSRIGDWSGVRAIIVGTGKYASKALALLKERGVVDISVYSPSGHVNNICNTEGVRNIFNLQTALSGCDLVVGCSSVDKPVITKQDIETAQASGSRTSRVRPVGRPSTDLTAIEASNRSRHVLIDLGLPRNFDPAISDLPTADLIDLDMLRVHAPFDNLAAEKMAHELAIESSSQFVNDCKQHEATPVIVSFRNYLESLTQTSLRRTDNCKHAQHALKHFVNSLIHIPLTRCKQLAANGESHKFAESMEILFDVKTDCTEGTQYQSSCGKSFD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium sp. (strain JLS)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.273 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSTDESDQAKIVDQVLQSSLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHCGMSLNDLTKYAYVRYAEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRALSVGKRVHSETGIDAAGASVVSVALDIAEAKLGSLAGRTAVVIGAGSMGALSAKHLVRAGIERVHVVNRSLPRARRLAQSLLDQGVTADAHTLDDIAHALADADVVITSTGAVRPVVSLADAHRGLTGRPEHRRLVICDLGMPRDVEPAIAGLPGVNVIDMERIQREPSARAAASDADAARSIVAAEVANYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPELDAAHRAEVAKTVRRVVDKLLHAPTVRVKQLASAPGGDSYAEALRELFELDQQAVDAVAAGELPLLPIELDKSE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium sp. (strain KMS)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.273 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSTDESDQAKIVDQVLQSSLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHCGMSLNDLTKYAYVRYAEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRALSVGKRVHSETGIDAAGASVVSVALDIAEAKLGSLAGRTAVVIGAGSMGALSAKHLVRAGIERVHVVNRSLPRARRLAQSLLDQGVTADAHTLDDIAHALADADVVITSTGAVRPVVSLADAHRGLTGRPEHRRLVICDLGMPRDVEPAIAGLPGVNVIDMERIQREPSARAAASDADAARSIVAAEVANYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPELDAAHRAEVAKTVRRVVDKLLHAPTVRVKQLASAPGGDSYAEALRELFELDQQAVDAVAAGELPLLPIELDKSE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium sp. (strain MCS)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.273 kDa
Sequence
MSVLLFGVSHRSAPVSVLEQLSTDESDQAKIVDQVLQSSLVTEAMVLSTCNRVEVYAVVDAFHGGLSVIGQVLAEHCGMSLNDLTKYAYVRYAEAAVEHLFAVASGLDSAVIGEQQVLGQVRRAYTSAEANHTVGRTLHELSQRALSVGKRVHSETGIDAAGASVVSVALDIAEAKLGSLAGRTAVVIGAGSMGALSAKHLVRAGIERVHVVNRSLPRARRLAQSLLDQGVTADAHTLDDIAHALADADVVITSTGAVRPVVSLADAHRGLTGRPEHRRLVICDLGMPRDVEPAIAGLPGVNVIDMERIQREPSARAAASDADAARSIVAAEVANYLAGQRMAEVTPTVTALRQRAADVVEAELLRLDNRLPELDAAHRAEVAKTVRRVVDKLLHAPTVRVKQLASAPGGDSYAEALRELFELDQQAVDAVAAGELPLLPIELDKSE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter acinonychis (strain Sheeba)
Length
447 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
51.599 kDa
Sequence
MELETTKYFILAFTHKSMSLEMREKLAINSPAILKEFLQTIKNYCPNIKECMVLSTCNRFEIYASLKHNTHADEQKNALLKILAQNKKMSVSDLEKCVLMSTDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKCAAKVRNLTGISKQGVSISSVAVKEALSIFEKEKIEDKKALVIGLGEMSQLVIKHLLNKQFEVLVLGRNAAKFEDFLKELEEPKKVSFQNIENLNAYINAYELLFCATSSPNFIVQNCMVKETIFRRFWFDLAVPRNIEKPIFNNIFLYSVDDLEPMVRENVENRQESRMKAYEIVGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKAVKKRYVPKEYESNIEKILHNAFNAFLHHPTIALKKNAQKEESDVLVGTIKNLFNLDKSSTNHAQNLNLYKCEYYEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Length
446 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.827 kDa
Sequence
MSLFALGLNHKSAPVNIREQIVFAPDAVTAALQHLRAHTTAREAAILSTCNRTELYVRMDDRAPEMLGEWLARYHRLDPEWLRDYLYLHEGAGAVRHLMRVSAGLDSLVLGEPQILGQAKIAYQGAIDAGTMGRVLDRLFQHAFSVAKQVRTDTGIGANPVSVAFAAVTLARQIFDDFQNRTALLIGAGETIELVARHLREQGLKNLIVANRNLERARQLVELEGGEAIPLSEIPTRLPEADVLVASTASPLPILGKGTVERAVRKRRHRPMFMLDLAVPRDIEPEAGNLDDVYLYTVDDLREVIAENRRSREEAAHQAEEIVQRQVDQFLSWRRAQQAVASICDFRERGHAHARELLQRANRRLRCGEPPERVLAWLSHTLTNRLLHAPTVGLREAAEAGDRERIELARTLLQIENANEDTRESVDKEQTGTTQGAARGDQRSTG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Arthrobacter sp. (strain FB24)
Length
446 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.394 kDa
Sequence
MVLFSLVATHADIDLETVAQLSTGASELATSALSGSPAVKGAVVLATCNRFEIYGEAPHPDDVEAARAALVAQISERTGLNEQLVSRSFNTRTGGEVSQHLFAVSSGLDSAVVGEREIAGQVRRALINAQHEGTASSGLVRLFQAASKTAKDVGAQTALGSRGLSIVSVALDLATDLSENPDWSAKKAVVFGTGAYAGATMSLLRERGCTDISVFSSSGRAEGFVATRGGKALDSDTLPAAVAAADVMIGCSGSDTRVEAEELARVRAGSAQTLIAIDLALTHDFDPAVGELDGVELLTLESVRLAAPQEQAESLAQASGIVTGAAAAFEQEREARSVDSAIVALRRHTMNVLDAEMEKVRARHGCTAAAEEVEFALRRMVKQLLHVPTVRARELASNGQQEQYIAALDALYGITVEQPAAAPAAECPVDHGRAGQAPADVRRETA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Length
446 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.612 kDa
Sequence
MHIVVVGLNNKTAPVSIREQVSFGEHEMKGAVVALRDEKSIFESVIVSTCNRTELYVVTDQPHTGRYYTKRFLANWFGLTMEELEPYLFIHEGFDAMKHLFRVTSGLDSMIVGETQILGQVKTSFFTAQKLETTGTVFNKLFKEAVTLAKRAHAETGIGENAVSVSAAAVTLAEQLLGSLEDKSIVVIGAGETGELTTLNLYEAGARDITVFNRTLAKAEEVANRFEGSAHSINEMQCGLLRADIVISSTGAKRAIIKREDIAAAQLFRSDRPFLLIDIAVPRDIEPTAGDLPGVHLYDVDDLTSIVQQNMAERMKEAAKIERRIEAAIAEFEGWMTTLGVVPIITELRDQSLKIQQETMQSLERKLPNMTNREKTVIGKHMKSIINQLLREPLSYIKDAAAKPDAEQRIAQFMDTFALDEELFDSAAEEMVLQEETTAERKAVNR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Macrococcus caseolyticus (strain JCSC5402)
Length
446 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.733 kDa
Sequence
MHIVVVSVNHKTADVSLREKLTFSESSIQQALSALINQKSILEGVILSTCNRTEIYAVTDQVHTGRYYVKSFMSEWFDVDIETIKSATDVKVGNEAIHHLFKVITGLDSIVLGETQILGQIRDSFLLAQSEGTTGTVFNKLFKDAITLAKRAHAETDISSKAVSVSYAAVELSKKILGKLENKKILIVGAGEMAELALQNLVGSGATDITVINRTAEKAKSLADQYGGRQVSLQELQCALIESDIVISSTSSQEFIITKPMMQDIMKLRKNKSLVLIDIAVPRDIDPEVNDIDLIFNYDVDDLKGLVDANLAERERAAQVIYTMIDKQVISFVDWINMLGVVPVITALREKALRIQATTMDSIDRKMPNLSERDRKVISKHMKSIINQILKDPISQAKEVSGSENRAEELQFFQEIFNITNEVESIKNNEPEVRRSKNSFVFNPEQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus megaterium
Length
446 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.838 kDa
Sequence
MHIIAVGLNFRTAPVEIREKLSFNEQELASAMKTLSGQKSILENIIVSTCNRTEIYAVVDQLHTGRYYVKAFLAEWFGIDKEEFSPYLTIYENDGAIEHLYRVACGLDSMVIGETQILGQVRSSFLLAQEEETIGTVFNQLFKQAVTLAKKAHHETEIGANAVSVSYAAVELAKKIFGDLSSKHVLILGAGKMGQLAVQNLYGSGAKKVTVVNRTFEKAQELANRFSGEAKPFADLQHALSEADILISSTGANDYVVTKQMMSEAERTRKGRPLFMVDIAVPRDLDPELDELETVFLYDIDDLNGIVESNLQERQKAADEIEIMLEAEIVAFKSWLGTLGVVPVISALRQKALTIQAETMKSIDRKLPDLSERERKVLNKHTKSIINQLLRDPIPHAKELAGEKHAEESLELFMKIFNIEQEVALQKEKEEQLHTSITSHSVAYQS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus carnosus (strain TM300)
Length
445 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.269 kDa
Sequence
MHIIAISINHRTADVALREKVAFKADAIRESHLDLFETKSILENVILSTCNRTEVYAVADQIHTGRYYIQRFLARKFGLEVDEIKEMSEVFVGDEAVEHIFRVTAGLDSIVLGETQILGQMRDAFFIAQEEGTTGTIFNHLFKQAITFAKRAHHETDIADNAVSVSYAAVELAKKVFGNLKSKHAVIVGAGEMSELSLLNLLGAGIDNITVVNRTKERAQQLAEKHQTQYADLSNLNELLVNADIVISSTSAQNYVITQEMMNNVLDQRRHEPMVLIDIAVPRDIDPAIELDMNVFSYDIDDLKGLVDANLRERQAAADQIAEQIPAEINEHNDWVNMLGVVPVIRALREKAMHIQQDTMDSIDRKLPDLSERERKVISKHTKSIINQMLKDPIKQAKELSNDKNSSEKLELFQNIFDIEAESEYKKSLAKKERKLSARHILGFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cutibacterium acnes (strain DSM 16379 / KPA171202)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.74 kDa
Sequence
MTVDHAEQGLGVVSEAAAQVDGLGLALTDHPQIRGALVLSTCNRVCLIVETSPEAVAQGFDEAALRRCIADHGANVLAESAQLVCENDAVWRLFRVAAGMESMVFGEREVAGQMKRALSEARREQTVSYTIGHVVEEALKTSRHVATETALAAEGRTVVAVGLDLVAQRMDLDGARVLVMGTGSYAGASCAQLSSRGVAEIQVHSASGRAAGFARRHRVSEALDIDAALAQADLVVTCRGSGVPALSAEAARRAVDARRGRDLMVLDLAISGDVEEPVPAGVEVIDLETIRQAVPASAEAERAAAEHIIATGVRHFAVDLERRRMAPAVVALRDVISDLVTAELERLPEEGSVPVDEVAASLRRLAASMAHIPSARARMASEQGLGDRWLNSLSDVLGIDVDIAAPVIDMSSFANADCMTCPVTGLRVEDLATDAAPRGEERTS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.167 kDa
Sequence
MLILVVGLNHRTAPVEVREKLSFSAKSLQGALAQLKSYPVIEGCAILSTCNRTEIYAATLEMDDGLNAIWDFLSRWSGVGISEIKNFTYSHTLYDTIRHLFRVAAGLDSMILGETQILGQVREAYQRAIEYESTNRVLNTLFQQAITVGKRVRTETGIDRNAVSISYAAVELARQHLGSLDGRSVLVIGAGKMSELTARHLVANGVSSVIVSNRSFERAVALAEQFRGRAVRFDELYRCMEAADIVISCTAASHCVVKAEEVSRVMDKRRGRAIFMVDIAVPRDIEAEVGNLAGVTLFDIDDLKNVIDQNLAERKQAAVKAEEIIEEELDGFMKWLGMQFVVPTISALKKWGDEIKQKELCRALNRLGNISEHDRKVICSMANSIVNQILHVPVAQLKSYALTTEGHLYTEILQNLFNLDVPGQKPKKQPAPAGIKEPVLAKKG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cutibacterium acnes (strain DSM 16379 / KPA171202)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.74 kDa
Sequence
MTVDHAEQGLGVVSEAAAQVDGLGLALTDHPQIRGALVLSTCNRVCLIVETSPEAVAQGFDEAALRRCIADHGANVLAESAQLVCENDAVWRLFRVAAGMESMVFGEREVAGQMKRALSEARREQTVSYTIGHVVEEALKTSRHVATETALAAEGRTVVAVGLDLVAQRMDLDGARVLVMGTGSYAGASCAQLSSRGVAEIQVHSASGRAAGFARRHRVSEALDIDAALAQADLVVTCRGSGVPALSAEAARRAVDARRGRDLMVLDLAISGDVEEPVPAGVEVIDLETIRQAVPASAEAERAAAEHIIATGVRHFAVDLERRRMAPAVVALRDVISDLVTAELERLPEEGSVPVDEVAASLRRLAASMAHIPSARARMASEQGLGDRWLNSLSDVLGIDVDIAAPVIDMSSFANADCMTCPVTGLRVEDLATDAAPRGEERTS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.167 kDa
Sequence
MLILVVGLNHRTAPVEVREKLSFSAKSLQGALAQLKSYPVIEGCAILSTCNRTEIYAATLEMDDGLNAIWDFLSRWSGVGISEIKNFTYSHTLYDTIRHLFRVAAGLDSMILGETQILGQVREAYQRAIEYESTNRVLNTLFQQAITVGKRVRTETGIDRNAVSISYAAVELARQHLGSLDGRSVLVIGAGKMSELTARHLVANGVSSVIVSNRSFERAVALAEQFRGRAVRFDELYRCMEAADIVISCTAASHCVVKAEEVSRVMDKRRGRAIFMVDIAVPRDIEAEVGNLAGVTLFDIDDLKNVIDQNLAERKQAAVKAEEIIEEELDGFMKWLGMQFVVPTISALKKWGDEIKQKELCRALNRLGNISEHDRKVICSMANSIVNQILHVPVAQLKSYALTTEGHLYTEILQNLFNLDVPGQKPKKQPAPAGIKEPVLAKKG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus anthracis (strain A0248)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.825 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.825 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus thuringiensis (strain Al Hakam)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.825 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus anthracis
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.825 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain AH820)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.825 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain ATCC 10987 / NRS 248)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.8 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQATELEQAMTTLQKQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPTLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRAWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain G9842)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.712 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEVMAEKYMGHAKSLSELQCALLEADILISSTGASEYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMVSLERKIPNLSDREKKVISKHTKSIINQLLKDPILVAKEIAAEEGASEKLALFAKIFDLETEEVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain 03BB102)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.783 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEVMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRAWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain B4264)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.712 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEVMAEKYMGHAKSLSELQCALLEADILISSTGASEYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMVSLERKIPNLSDREKKVISKHTKSIINQLLKDPILVAKEIAAEEGASEKLALFAKIFDLETEEVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain AH187)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.727 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELEQAMTTLQNQKSVLENVIVSTCNRTEVYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVVFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPTLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRAWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.175 kDa
Sequence
MHILVVGVNYRTVPVEIREKLTFQETELKRAMTTLQSQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEISPYLSIFEQDGAIEHLFRVTCGLDSMVVGETQILGQIRNSFLTAQEVKTTGTIFNELLKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGDLTDCHVLILGAGKMGELALQNLYGSGVQKVTVMNRTFTKAETMAEKYMGHAKPLSELQCALLEADILISSTGSSNYVITKEMMKKVERMRSGRPLFMVDIAVPRDIDPEINELEGSFLYDIDDLQDVVEANRAERLKEAEKIQFMIEEEIVLFKNWLNTLGVVPLISALREKALGIQSETMRSLERKIPTLSDREKKVISKHTKSIINQLLKDPILVAKELAAEEKATEKLALFAKIFDLEVQEEVEHTEELEHKRAWTPSVSSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain Q1)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.727 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELEQAMTTLQNQKSVLENVIVSTCNRTEVYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVVFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPTLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRAWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mannheimia succiniciproducens (strain MBEL55E)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.41 kDa
Sequence
MTILVLGINHKTASVALREKVAFSPEKRDLAFQQIAQSELAQSEVILSTCNRTEIYLHNKHISPEADQENQRWLEQCIQWFADVHQLDVDELRNCLYIKQNQSAVNHLMRVSCGLDSLVLGEPQILGQVKQAYQYSEDYCQAQHMPMSSEFSRLFQKTFSVAKRVRTETNIGNSAVSVAYAACSLARQIFEGLKDLNILLVGAGETIELVARHLLRHGVKKLMISNRTLARAELLVEKLEHNKYIQVLSLQQLQDGLNQADIVISSTGSPIVLITAEMVKQAQQKRRNAPMLIVDIAVPRDVDERVEKLDGVYHYTVDDLHSIIQRNLSEREKASKEAETIIDAEASDFFEWMKVHQFSNLIRTYRESAEQIRQDLLEKAVQAIGQNEDPETVLQELSYKLMNKLIHSPTQAMQAMMKQGSIQGLRSFSSALGIADKKERNPQK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.712 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAEIERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEVMAEKYMGHAKSLSELQCALLEADILISSTGASEYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMVSLERKIPNLSDREKKVISKHTKSIINQLLKDPILVAKEIAAEEGASEKLALFAKIFDLETEEVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus cereus (strain ZK / E33L)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.797 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRAWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Length
444 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.825 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELERAMTTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVITLAKRAHSETTIGESAMSVSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLSKAEIMAEKYMGHAKPLSELQCALLEADILISSTGASDYVITKEMMTKVEKMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTLGVVPLISALRDKALAIQSETMESLERKIPNLSDRERKVISKHTKSIINQLLKDPILVAKEIAAEEGADEKLALFAKIFDLEMEDVESRAEEVEHKRVWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543)
Length
443 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.794 kDa
Sequence
MSVLLFGASHRSAPVPVLEKLAIGEADQPKIIEHILQSPLVTEVMVLSTCNRVEVYAVVEAFHGGLTVIGEAIARHAGMGMNELTKYAYVRYSEAAVEHLFAVASGLDSMVVGEQQVLGQVRNAYATAESHQAVGRVLHELSQSALRVGKRVHSETGIDAAGASVVSVALNLADNKLDGLPGRTAAVVGAGSMGSLATAQLIRAGIDNLWVVNRSAERARRLAATAREAGVNAQAITLDNLDQALAQADVVVSCTGAVRPVISLADVHHALEGGRQLVFCDLGMPRDVDPTVAGLPGVVVVDMERIQREPTARAAANDAGAARQIVNDEVARYLTGERMAEVTPTVTALRQRAAEVVEAELLRLDGRLPGLAGAERDEVAKTVRRVVDKLLHAPTVRVKQLASAPGGDSYAEALRELFELDPHTVEAVATAGELPLATKELHE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Length
443 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.78 kDa
Sequence
MHLIAVSINHRTADVALREKVAFKDDAIRSANVDLYETKSILENVILSTCNRTEVYAVADQIHTGRYYIQRFLARSFGLDVEDIKNMTEVKVGDEAVKHLLQVTSGLDSVVLGETQILGQIRNAFFLAQEEDTTGTIFNHLFKQAITFAKKAHNETDIADNAVSVSYAAVELSKKVFGKVNNKQALIIGAGDMSELSLLNLIGSGVTDITIVNRTLSKAQDLAMKHHVKFEPMESLPRLLVDVDIVISSTSSENYIVTNEMLQSISTERKHDSLVMIDIAVPRDIEPNIDTIHDMFSYDVDDLKGLVDANLRERQLAAEQIIQNIPNEIEAHNEWVNMLGVVPVIRALREKAMSIQEDTMDSIDRKLPGLSERERKIISKHTKSIINQMLKDPIKQAKELSSDKKSNEKLELFQSIFDIEAENAYEAKKQKNNMKTGQILSFE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Length
443 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.837 kDa
Sequence
MSVFALGLNHTTAPVDLRGRFAFTLEQLAPTLQGFRERLTTGQRPGTPEAAILSTCNRTELYCAAEPQLVRPALEWLAGVGGVGADTLSHHAYMLEGGEAARHAFRVASGLDSMVLGEPQILGQMKQAVREADAAGTLGSTLHQLFQRSFAVAKEVRTATEIGTHSISMAAAAVRLAAQLFEDLREIRVLFVGAGEMIELAATHFSARAPARMAVANRTLERGERLASRFGAESIRLSDLPQRLHEFDAVVSCTASSLPLIGLGAVERALKVRRHRPIFMVDLAVPRDIEPEVARLDDVYLYTVDDLSAIVQSGGEKRLAAVAQAEAIIETGVQSFVHWLGQRGTVPLIQALNAQADSWRENELVRARKLLARGESVDAVLDALSRGLTQKMLHGTLAELHASDPAQRAQLATTVSRLFLRGAIPPDAVRPSGPREDDHLDGV

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bacillus weihenstephanensis (strain KBAB4)
Length
443 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.51 kDa
Sequence
MHILVVSVNYRTAPVEFREKLTFQAAELEQAMNTLQNQKSVLENVIVSTCNRTEIYAVVDQLHTGRYYIKKFLADWFQLEIEEVAPYLSIFEQDGAIDHLFRVTCGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNELFKQVVTLAKRAHSETTIGESAMSVSYAAVELGKKIFGDLTDCHVLILGAGKMGELALQNLYGSGARKVTVMNRTLTKAEVMAEKYMGHAKPLSELQCALLEADILISSTGASEYVITKEMMTKVERMRSGRPLFMVDIAVPRDIDPAIDELEGSFLYDIDDLQGVVEANRAERLKEAEKIQFMIEEEMVLFKTWLSTLGVVPLISALRDKALAIQSDTMESLERKIPNLSDREKKVISKHTKSIINQLLKDPILVAKELAVEEGAGEKLALFAKIFDLEVEEAGNTEEVEHKRAWTPSVPSL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Heliobacillus mobilis
Length
443 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.577 kDa
Sequence
MFIFVVGLNHKSAPVEVREKLSFTEAQLSEALHKLQGMAGIEGCCILSTCNRTEIYGASTDMEKGMTAVKRFVLEWGQLQPQDFSKYFYVHTLYDAIRHLFRVASGLDSMVLGETQILGQVRTAYQRSCNEDCSNGIVNTWFQQAITVGKRVRTETGIDQHPVSISYTAVELAEQVLGGLKGRTAMVLGAGKMSVLTLKHLVAEGVDKIIIANRSVEKAEELAKSCGGEAISFADVNHRLEEADILISCTAATHYVIRKSMVEQVMDRRGGKPVFFFDIAVPRDIDPEVAQVPGTHLYDIDAMQHVIDRNLAERRKCAAEAEIIIEHEINQFMRWLNSLFVIPTIVGLKNKGNQIKEKELDRALCKLKHLSEKEKKLVGSLASSIVNQLLHDPITQLRHYAASPEGHLYSEILQNLFCLDVPGQRQKHVVVHYPAVEQRQNRA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Length
442 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.057 kDa
Sequence
MALMVVGLSHRTASLEVLERAAFDARGAEEVLRALTASPHVEEAFVLSTCNRVELYCDVSRFHGGVADIGDVLCRRIGRGLDELGDQLYVHYEDAGVEHLFKVACGLDSMAVGESQILGQLRLALRGLHERGLAGGTLDRLLQTALRVGKRAHSETRLDAAGASLVDTAMTRAAGVVGELPGRRALVVGAGAMSALVATTLARAGLDVVVANRTPDRAQRLAAAVGGRATGLDDLRAEVAAADLVVSCTGAVGHVLDVATVASALLDRPERPLFLADLALPRDVHPDVATLRGAHLVDLEGLGADLASSAVAQDLRAVRAIVAEEVAAHAASLRAADVAPTVVALRAQARHVVEVEMRRLASRVDLDDTTRSEVDRAVHRIVEKLLHTPTVRVKELAEAPGGVGYAAALRALFDLEVTAQGGALPGDAPLSGTVADAVGHVS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain RCC307)
Length
442 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.791 kDa
Sequence
MHLAVVGLSHRTAPVEVRERLSIPEHHLETSLQSLRSHEQVLETSILSTCNRLEIYSLLRHPEDGVEAIRDFLANHSGLADPDLQPHLFALHHEEAIQHLLRVSAGLDSLVLGEGQILSQVKKMYRLGQDHKSIGPILNRLLNQAVSTGKRVRSETNLGSGAVSISSAAVELAQLKVGQEQGVDDLVSLSQEKVAVVGAGRMARLLLQHLQSKGARSITVVNRTVAKAEVLAKDFPDLVITCCGLDQLDAQLASNTLLFTSTGADEPIIDRQRLDAITRQARLMLVDIGVPRNISSDAADVSGTLSYDVDDLQEVVERNVAARQQLAQQAEVLLDEDRQAFLDWWDGLEAVPTINRMRQQFEEIRKQELLKALSRMGSDFSQREKQVVEALTKGLINKILHGPTTALRAPQPRQQRLDSMAAAQRLFDLPGDDADRDRSDAK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain NATL2A)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.801 kDa
Sequence
MHIAVVGLSHRTAPVEVREKLSIPEELVEKSFNNLKKIDQILEVSILSTCNRLEIYSLVKDPQLGIEAIKSFLLQFSGLDDEILSPHLFNYVQEKAVSHVMRVSAGLDSLVLGEGQILSQVKKMVRLGQDHHSLGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQAHGRDQLMTLETEKVAVVGAGRMSRLLLQHLQSKGCCSLTLLNRTKKRAEDLSAAFPDIQIDCQLIDELDSCLSLSTLVFTSTAANEPIIDAEKLIKIDRKPLLRLIDIGVPRNISSDAKSVSGIESHDVDDLQEVVSRNQEARQKLALEAEGLIEEECRVFLEWWDSLAAVPTINCLRSGLESIRKEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTKLRAPQSRNDRRDSLDVIEKLFNLDVSSSLNKPKNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.57 kDa
Sequence
MVLFSLVATHADIDLETVAQLSNGSSGIAASVLSGSPAVSGAVVLATCNRYEIYGEAPNTDDVEAARAALVAQISAQSGLAEPLVSRSFSTRTGPEVTRHLFAVSAGLDSAVVGEREIAGQVRRALITAQHEGTASSGLVRLFQAASKTAKDVGAQTALGSRGLSIVSVALDLATDLSENPDWSAKKVVVFGTGAYAGATMALLRERGCTDVSVFSSSGRAEGFVATRGGTALDADSLRPAVAAADVMIGCSGSDTRVEADELAQVRAGSAQPLIAIDLALTHDFDPAVGELNGVELLTLESVRLAAPQEQAESLAQASGIVKGAAKAFEQEREARSVDSAIVALRRHTMDVLDAEMEKVRARHGCTAAAEEVEFALRRMVKQLLHVPTVRARELAANGQQDDYVAALEALYGITVEQPGTAAPAAGQAECPVDHKGLESA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain NATL1A)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.888 kDa
Sequence
MHIAVVGLSHRTAPVEVREKLSIPEELVERSFNNLKKIDQILEVSILSTCNRLEIYSLVKDPQLGIEAIKSFLLEFSGLEDEILSPHLFNYVQEKAVSHVMRVSAGLDSLVLGEGQILSQVKKMVRLGQDHHSLGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQAHGRDQLMTLETEKVAVVGAGRMSRLLLQHLQSKGCCSLTLLNRTRKRAEDLSAAFPDIQIDCQLIDELDSCLSLSTLVFTSTAANEPIIDAEKLINIDRKPLLRLIDIGVPRNISSDAKSVSGIESHDVDDLQEVVSRNQEARQKLALEAEGLIEEECRVFLEWWDSLAAVPTINCLRSSLESIRKEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTKLRAPQSRNDRRDSLDVIEKLFNLDVSSSLNKPKNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain NATL1A)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.888 kDa
Sequence
MHIAVVGLSHRTAPVEVREKLSIPEELVERSFNNLKKIDQILEVSILSTCNRLEIYSLVKDPQLGIEAIKSFLLEFSGLEDEILSPHLFNYVQEKAVSHVMRVSAGLDSLVLGEGQILSQVKKMVRLGQDHHSLGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQAHGRDQLMTLETEKVAVVGAGRMSRLLLQHLQSKGCCSLTLLNRTRKRAEDLSAAFPDIQIDCQLIDELDSCLSLSTLVFTSTAANEPIIDAEKLINIDRKPLLRLIDIGVPRNISSDAKSVSGIESHDVDDLQEVVSRNQEARQKLALEAEGLIEEECRVFLEWWDSLAAVPTINCLRSSLESIRKEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTKLRAPQSRNDRRDSLDVIEKLFNLDVSSSLNKPKNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.018 kDa
Sequence
MFVVAAGLNHRTAPVAIREQLAFARHGLPPALCRLKEEAGVEGCVILSTCNRTEVYIACNQEEAGLKAAKNFLGRSCKLALADLEGYLYTLNTHHAVRHLFRVAAGLDSMILGEDQVLAQVAEAYQVARETGTTNNVLNTLWQQAIYAGKRVRTETRIDANTVSVSYAAVELARQVFHDELDGRTVLVIGAGKMSTLAARYLKDKGVTTVLVSNRSYDRAVALAATIGGQAVRLDALEDYLPRADIVISCTAASHYILHRDQVARAVAARPGVPLMLIDIAVPRDIEPAAGDLPGVKLYDIDDLQQVVLANLEERKKAARQAEGIIAAEAEAFFQWLGSLYVVPTIVALKEKAEAIKNAEVRRACNRLGQLTTREQKIITSMATTIVNQLLHDAIVNLKAAALTPRGHLYVEALQELFELRVDHTLPGPDMAVSVEGGRKY

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfurihydrogenibium sp. (strain YO3AOP1)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.905 kDa
Sequence
MVIFSTGFNYKTAPVEIREKLAITENNYGLILEKLNSIEDIYEICVISTCNRVELYGVSNDNIEKVKEEILRILSQYSTVPVNTLKDYLFFYTNKEAIRHIFRVSSSLDSMVIGEPQIVCQFKDSFTKAKEYKAVRHILTRLFDKALNVSKKIRTSTGISRRAVSISYAAVLLAKKIFGDLKDKNVLIIGAGEMAELAAKHLHSLNVKHIFVSNRTFEKAVELADKFSGSAIRFEKIQEFLPEADIIIVSTGAKEPILKKEDVKRAIKSRKDPLFIIDISVPRNVEESVNELEGVYLYNIDDLKQVVNSNLEERKIEAQRAEFIIDEEVEKFVKWLNALKVSPIISSVRDYADKLRQQQLEKLFKQMPYLNEKERETIDLAMRSLINKLLHRPTMYIKDKAAKEGNTEVVKIFEDMFSSKWDFRKKGKNLEEIEDIVREEQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia pseudomallei (strain K96243)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.258 kDa
Sequence
MGLNDSLLDMQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.266 kDa
Sequence
MPAAARVPLFVDDLVMVGVNYKTSGKELVEKAQFPDPLAAYSAISRIPAVREVVLLQTCNRVEVYAITTNKKATVESIKSLLEARAGEPIPEEKFVIYYGTDAVRHLFRVAAGLESMVLGEPDILRQVREAAEFAAKEGYIGKALKLTFENAVRVGKRVRTETALGKGSIGIPSASVKLLEELIGLEGKKLLVVGAGMAGRVVAVNAAKRGAKVIIVNRTLSKAKELAEEVGGEAYPLEELPRLLREADAVVVAVGGGSKVITRDAVAEVNKKLVIVDISEPPAVDPGVSLNPYVIYKDMLAVAEVANRGLEKRKSEIKRAEDIIEAELNKFVNFAQRVLADKILRELMEKVEQIRINELSKAMAKVPQEYAEVLDKMTSSLVKKVLKDVILKVREAAGKGDLTTLRIVAEVFDLKESLNNIEIIYDYNGVEQELKRKLEL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.703 kDa
Sequence
MLLSVSASHRDADLADLERLSSGVGRVWADAPLVAHGLDGAGVVLLATCNRFEVYLDVADGTDPQRALAVVRDLVRTVPESPLAAPGADDDAAGPGPDPSAALRVRVGDDAARHLFGVASGLDSIVVGEREIAGQVRRAIAAARRAGTTTGALERLFAQAQRTSRAVEAGTGLAAAGRSVVGVALDLAARSAPPWPLARVVLIGTGSYAGASLAALRARGCTDVRVHSESGRAEEFARAREAEAVPPGELLTAIADADVVVSCRGSVRPVLDAAAVAGARAAAERRAEERAGHAVGTAVQPRPLVVVDLALHRDVDPAVGSVDGVELLDLGTIRAHAPAAATRDVERAREIVDDAVAQHALVRAAREMDPAITRLRGRVREVLDAEVGRLPVGPVSREDAERALHRLAATLAHAPTEAAREAARAGRGEEYVEALRLLFPD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Myxococcus xanthus (strain DK 1622)
Length
441 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.681 kDa
Sequence
MELICIGLSHRTAPLTVRERLALPESRQVDVLQRLAQAPVEALWVSTCNRVEVYLFAPDAAMARQRALMELQVLGGVEALEHLYEHQGEAALVHLFRVACSLDSMVLGEAQILGQVKEAFERGQGAGAVRGELMRACAAAFSCAKRVRTETAIGRAATSMAAAAVQLASKVFDGLAGKTVLVVGAGEMGELAARHLKQAGASKLYVTNRTLSRAEALAAEVGGQARPFEELLGLVAAADVVVCSTASQAPLFTRDNVGALGRGRRGRPLFMVDLAVPRDIDPAVGTLDWVHAYDVDDIQKFVADNAAARAEEAQKAGVLVAQEVARFVKERALREGTPVLARLRQRAEAIARSEVERTLGALGDGLNEKQRKSIEAMGRAIVNKLLHEPTARLRAVGPEGEGNRLAGAAAELFGLLEEEVGTAAAAPSVMAAPVQVATGGK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Length
440 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.781 kDa
Sequence
MNVVVLFSLVATHADIDLETVARLSAGSAAVSTSTVVLATCNRFEIYSAAENPATARAEMEAALAHATGFAPSLVSSSFKLLTGTDVAKHLFAVASGLDSAVVGEREIAGQVRRALIDAQTAFPVPGPLVRLFQTASRTAKDVGSQTALGSQGRSIVSVALDLAGDSSATAWDQRKAVVFGTGAYAGVTMALLRERGVSDLSVYSSSGRAADFVASRGGTAAESLEEALGSADLVIGCSGSDQRVSAETLADIRRRTGTAGEPLSVIDLALSRDFDPAITELPGVELLTLETVRLAAPSEQESALLQTQVIVSRAAADFELSIATRSVDTAIVALRKHTMAVLDAEMERVRAQHGCTAAAEEVEFALRRMVKQLLHGPTVRARELAAAGQQAEYIAALQSLYGIELESPTPAAQPVESIPAVEPASCPVNHNAVDRSQSA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Length
440 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.37 kDa
Sequence
MQEKMEVQYMVVSFSHKNVDIATREKLSFSQEEIVPFLQEINVCDSIRESILLCTCNRVELYVSMIDKKRAREHIYECFCTHKNIALEDIKNIALMRLNQYAIYHIFSVASSLDSLVIGETQITGQLKLAYKLAFENALCAKDMTRLMHFAFKCAASVRKETDISAHSVSVASTAVRMAEQKLALCDKTLENLPVLVIGSGEMGRLACKHLQNANAQITLVSRTKENARKLALELDSSINIESWEHLEQLLGQYEVLFSATSAPNCIIQSKMVQVSQKQRWWFDLALPRDIENIQMENLHIFCVDDLEEIVQEHKNAREDSAKKAQKILERYSVEFFKWLQTLGIDPIIKHIRYLAKQSALKELDRAVKKGFLPASYQQNVEKILHGAFNTFLHQPTIRLKQASENPQGDPIIEAMKNVFDISDDVVMLNGYKCEKDTIF

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
Length
439 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.607 kDa
Sequence
MLICLTASHHNASFEVLEKLSVAAPSVAGALMEQNDFIAGAVVLATCNRFEAYLDVEEPLTAARALAVEATVDVVSGASGIARDDVRGSVDVKCGDAVAEHLFAVSSGLESVVVGEGEIAGQVRRALEGARTGGTTSTGLERLFQTASNTSRGVKTRTGLQSAGRSMVRLALDLAESRIADWSATRVLLVGTGAYAGASLAALRDRGVVDVHVYSPSGRAQKFAGPHGIPAVEGRDLLRALAASDMVVTCSTAPTAVLAAHHMQGAAAVSGDGRRRLVIDLGLPRNVDPDVVTVDGVELLDLETISLHAPLRDLTATDDAREIVSTAAAEFRAASAEDEVAPAVVALRTHIFDVLEGELERVRKRGDSSDATEKALRHLVSVLVHQPSVRARELARQGEGARVVDAVQALFGLDVEMPAAVSSPVAVALSRTAEAGQAS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1)
Length
439 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.647 kDa
Sequence
MLICLTASHHNASFEVLEKLSVAAPSVAGTLMEQNDFIAGAVVLATCNRFEAYLDVEEPLTAARALAVEATVDVVSGASGIARDDVRGSVDVKCGDAVAEHLFAVSSGLESVVVGEGEIAGQVRRALEGARTGGTTSTGLERLFQTASNTSRGVKTRTGLQSAGRSMVRLALDLAESRIADWSATRVLLVGTGAYAGASLAALRDRGVVDVHVYSPSGRAQKFAGPHGIPAVEGRDLLKALAASDMVVTCSTAPTAVLAAHHMQGAAAVSGDGRRRLVIDLGLPRNVDPDVVTVEGVELLDLETISLHAPLRDLTATDDAREIVSTAAAEFRAASAEDEVAPAVVALRTHIFDVLEGELERVRKRGDSSEATEKALRHLVSVLVHKPSVRARELARQGEGARVVDAVQALFGLDVEMPAAVSSPVAVALPRTAEAGQAS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Persephonella marina (strain DSM 14350 / EX-H1)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.257 kDa
Sequence
MEIFAVGLNYKTAPVDVREKLAISEDQLSGLLKKISEINSIYEVSILSTCNRVEIYGVTDDPDDAFNRIVQILSSYSGLQKNELEKYLFKLTGREAIKHIFKVSASLDSMVIGEPQIVCQFKDAFTKAREEKTVRHILTRLFDKALNVSKKIRTSTGISKRAVSISYAAVELAKKIFGDLSDKNVLLLGAGEMAELAARHLSSSGVKHIFVSNRTFEKAVQLAEEFGGSAIRFDKLFEFLPESDIVIVSTGAKEPILRKEHFEEINRIRKGDPVFIIDISVPRNVAEDVNDVDNVYLYNIDDLKVVVDKNLEERKLAALSAEMMLDEEVHKFEHWLNQLKVAPLITKIRNYADEIREYQLEKLFNQMPYLNEKERENIDLAVRAIINKLLHRPTMYIKDKASKENKDFYVDILDEMFSSKWDLRKLKEKEKKKNVKKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.347 kDa
Sequence
MKLLTLGINHHTAPVAIREKVAFDPEFLQEALHDLRQHLLGANQSGLPEATILSTCNRTEVYCAANDANAANILHEATFDWLAKTQQLAPSSLQPHIYSLPQSDAVRHAFRVACGLDSMVIGETQILGQMKDAVRTANDAGVLGTYLNQLFQKTFAVAKEVRGSTEIGTHSISMAAASVRLSERIFEKISEQKILFIGAGDMITLCATHFVARKPKNVAIANRTIERGQELADSISAQDVQAESLKLSELPGRLHEFDIIVSSTASSLPIIGLGMVESALKQRRHKPMVMIDLAVPRDFEPEIARLDDVYLYTVDDLGVMIQTGTNLRQAAVSQAEAIIEDRVGNFMHWMQGRNAVPVIQDIQQQGERLRQLELERAMKRLMRGDDPQEVLNAMAQGLTNKFLHGSLHALQHSNGAERDALIKLLPKLFASHSKPEDH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Persephonella marina (strain DSM 14350 / EX-H1)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
50.257 kDa
Sequence
MEIFAVGLNYKTAPVDVREKLAISEDQLSGLLKKISEINSIYEVSILSTCNRVEIYGVTDDPDDAFNRIVQILSSYSGLQKNELEKYLFKLTGREAIKHIFKVSASLDSMVIGEPQIVCQFKDAFTKAREEKTVRHILTRLFDKALNVSKKIRTSTGISKRAVSISYAAVELAKKIFGDLSDKNVLLLGAGEMAELAARHLSSSGVKHIFVSNRTFEKAVQLAEEFGGSAIRFDKLFEFLPESDIVIVSTGAKEPILRKEHFEEINRIRKGDPVFIIDISVPRNVAEDVNDVDNVYLYNIDDLKVVVDKNLEERKLAALSAEMMLDEEVHKFEHWLNQLKVAPLITKIRNYADEIREYQLEKLFNQMPYLNEKERENIDLAVRAIINKLLHRPTMYIKDKASKENKDFYVDILDEMFSSKWDLRKLKEKEKKKNVKKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.347 kDa
Sequence
MKLLTLGINHHTAPVAIREKVAFDPEFLQEALHDLRQHLLGANQSGLPEATILSTCNRTEVYCAANDANAANILHEATFDWLAKTQQLAPSSLQPHIYSLPQSDAVRHAFRVACGLDSMVIGETQILGQMKDAVRTANDAGVLGTYLNQLFQKTFAVAKEVRGSTEIGTHSISMAAASVRLSERIFEKISEQKILFIGAGDMITLCATHFVARKPKNVAIANRTIERGQELADSISAQDVQAESLKLSELPGRLHEFDIIVSSTASSLPIIGLGMVESALKQRRHKPMVMIDLAVPRDFEPEIARLDDVYLYTVDDLGVMIQTGTNLRQAAVSQAEAIIEDRVGNFMHWMQGRNAVPVIQDIQQQGERLRQLELERAMKRLMRGDDPQEVLNAMAQGLTNKFLHGSLHALQHSNGAERDALIKLLPKLFASHSKPEDH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus elongatus (strain PCC 7942)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.445 kDa
Sequence
MHLAVVGLSHRTAPVAVREKLSIPEQQVEAAIQQLKSYPHIEEVAILSTCNRLEIYCVTRATEPGVREITQFLSEHSHLPLGELRPHLFVLLHQDAVMHLMRVAAGLDSLVLGEGQILSQVKTMYKLGQQYEGVGRILNRLLKQAVTAGKRVRTETSIGTGAVSISSAAVELAQLKVIARDDRSDGNLAGQRVLILGAGKMSRLLVQHLIAKGADTIQILNRTLGRAEELAKQYGGDLQIQVGLLSGLMNAIVEADIVFTSTSATDPILDRAKLEMVLAPEQRLMLIDIAVPRNVAADVVELTSVESYNVDDLREVVAQNQESRRKLAEEAEALLEEEVDAFDNWWQSLDTVPTINCLRDKIEMIREQELEKALSRLGTEFGDKHQAVVEALTRGIVNKILHDPMVQLRSQQDIEARRRAVDALQMLFNLDPQGQLSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.918 kDa
Sequence
MSVLVVGMSHRSAPVALLEKLSMDDGVRTNTVSDLVARPSLAEAMIVSTCNRLEVYAMTSSFHTGVNDVVEVLHDMSGVDMEELRGYLYVRYADAAAEHMMEVTSGLDSMVVGEQQIIGQVRTAYHSATEAGTVGPALHGLVQASLHTGKRVHTETDIDDAGASMVSFACDEALAQMSATNFAGCRALVLGAGAMASLAATHLGRLGIEHITVANRTFERAQRLADHAVEAGVAASAIEFERRMDVLCDVDVVVSATGANTFTIEAANIPAAHGDLMMIDLSLPRDISDDVAEVPGVHLVNIEKLRDVASSGEAKDHAAQRIVAEELEAYTSAQRIRDVAPAVAALRRHASSLIDSELARLSTRVPSMDEDDFSEVQRTVRRVVDKLLHQPTVRVKELAAQSGTVSYDTAIQELFGLAVEATPVAVNVDELPERINKR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.445 kDa
Sequence
MHLAVVGLSHRTAPVAVREKLSIPEQQVEAAIQQLKSYPHIEEVAILSTCNRLEIYCVTRATEPGVREITQFLSEHSHLPLGELRPHLFVLLHQDAVMHLMRVAAGLDSLVLGEGQILSQVKTMYKLGQQYEGVGRILNRLLKQAVTAGKRVRTETSIGTGAVSISSAAVELAQLKVIARDDRSDGNLAGQRVLILGAGKMSRLLVQHLIAKGADTIQILNRTLGRAEELAKQYGGDLQIQVGLLSGLMNAIVEADIVFTSTSATDPILDRAKLEMVLAPEQRLMLIDIAVPRNVAADVVELTSVESYNVDDLREVVAQNQESRRKLAEEAEALLEEEVDAFDNWWQSLDTVPTINCLRDKIEMIREQELEKALSRLGTEFGDKHQAVVEALTRGIVNKILHDPMVQLRSQQDIEARRRAVDALQMLFNLDPQGQLSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain WH7803)
Length
438 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.011 kDa
Sequence
MHIAVVGLSHRTAPVEVREKLSIPEQTMEESLQNLRGHDQVLEASILSTCNRLEIYTLVRNPELGISAVREFLSSHSGLETGDLKPHLFAYHHEDAVGHLLRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQSRGLDELVTLEDEQVAVVGAGRMSRLLLQHLQAKGASGVVVLNRTVARAEALAADFPTLPVQCRPLKDLDHCLSTCSLIFTSTAADDPIIDAERLSKLNRRSSLRLIDIGVPRNIAADVEGIGGVDAHDVDDLKEVVERNQEARQQVAREAQGLLDGEARQFLEWWDSLEAVPTINRLRSSMESIRSEELMKALSRMGPDFSARERKVVEALSKGIINKILHTPVTALRSPQPRSDRQNALSVVERLFDLQADEDSVQN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Length
437 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.174 kDa
Sequence
MNIAVVGLSHRTAPVEVREKLSISDEHIEKSFCSLNATEQVLEVSILSTCNRLEIYALVKNQELGVSAIKEFLIDHSGLSKEDLFPHLFTFNQAEAVNHLMRVSGGLDSLVLGEGQILSQVKKMVRLGQDYKSIGPILNRLLTQAVSTGKKVRSDTNLGTGAVSISSAAVELAQLKLGQSLGKDQLMTLQSEKVAVIGAGRMSRLLIQHLQSKGCSKLTLLNRTLNRAESLAKDFPDLDVKCGLLDDLDKCIEFSTLIFTSTASNTPIINSELLSGFKRNNNLLRLIDIGVPRNIASDVSGLPGFEAYDVDDLQEVVARNQDARQQIAIEAQNLIDEEARVFLEWWASLEAVPTINRLRSNLESIRKEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTNLRAPQPSSQRKESLKIVESLFELGVSENDQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Length
437 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.174 kDa
Sequence
MNIAVVGLSHRTAPVEVREKLSISDEHIEKSFCSLNATEQVLEVSILSTCNRLEIYALVKNQELGVSAIKEFLIDHSGLSKEDLFPHLFTFNQAEAVNHLMRVSGGLDSLVLGEGQILSQVKKMVRLGQDYKSIGPILNRLLTQAVSTGKKVRSDTNLGTGAVSISSAAVELAQLKLGQSLGKDQLMTLQSEKVAVIGAGRMSRLLIQHLQSKGCSKLTLLNRTLNRAESLAKDFPDLDVKCGLLDDLDKCIEFSTLIFTSTASNTPIINSELLSGFKRNNNLLRLIDIGVPRNIASDVSGLPGFEAYDVDDLQEVVARNQDARQQIAIEAQNLIDEEARVFLEWWASLEAVPTINRLRSNLESIRKEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTNLRAPQPSSQRKESLKIVESLFELGVSENDQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Length
437 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.442 kDa
Sequence
MVLFCLVASHRTVDLNTVARLSTGALGVAEDAVSRGALAGAITLSTCNRLELYGELPEHASVDVPGAQQQLAERIARRAGLDERFVLETMDAYEGPEVPRHLFTVVSGLESAVVGEREITGQVRRALAGAQQSGTASPHLVQLFEAAARTAREVGASTGLGERGRSIVSVALDLADDITSGDWPERHALVFGTGAYAGATMAALRDRGCADIEVYSGSGRAQQFTDQRGGSPVTDESLPGALRRADVIIGCSGGSAPMPASRFPAGPRTVVDLALARDFDPAVADLPNVELITLESVRVAAPEETRESVAAAREIVERAARDFENARTARSMDQAIVALRKHTMAVLDAELDKVRTHHGCTGAEEQIEMAMRRMVRSLLHTPTVRARQLAAEGRADEYITGLEALYGLEVAVPDVPEETAPSTRQDPSDTPRPRAVG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
437 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.442 kDa
Sequence
MEIGCITISHKNAKVEEIEKIWLTVKPRLEDVISKCSFSEYAYIFTCNRFEIYLVGENLKSCLQDIAEELGITGKAEIFVGESCLRHLLRVASGIESMIVGEEQILGQVRQCFNLCREGGQAGEVLERVFGKAVQVGRRVRRETAISKGSVSIGSAAVEVAERVLGTLKGKKALLVGAGEMGTLVAKAIAGKEVEAVLIANRTYEKAEELAKRIGGVAVKFDKLVDYLKVCDVVISATSAPHAVITRGDVERAMRERSQKLLIIDIALPRDVDESVAQLDGVELLTIDDLRRISEENLARRREEIAKVEGIIEEELEQLKLLLKDISARDAIAAMYSLAERFVGEEVEELYAKLNARYGVSEDVKEILNDFANSLIKKFLREPTVRLREAARKDEFHVIESIKYVFGDGNGRVSEGKDAKVEEGKPEVDVQRSKAES

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Length
437 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.497 kDa
Sequence
MNLIAVGVNHNTAPIELREKISLTDSMARSLLTELIDSKLASEALVLSTCNRTELYVVPAMPEVTANYLKDYLIAHKGVRKEVTRDHFFNYFACGAARHFYNVACAIDSLILGEVQIIGQVKTAYNRAVEMKTVGPILNKMCHTGFGLANRVRSKTKLTAGAVSVSYAAVELTQKIYSDVSTKNILLVGAGDTAKLAAKNLLDKRVRDFYITNRTYEKAELLAQELGTGKILPLEEMTERLHEFDIVVTAVGGNDHIIKKEHVAAAMQKRHRDPILILDLGLPRNVAPEVGQVNNVFLKDIDDLKMIIDSNLEKRRAEIPKVKHFIQKELIEYARWYFSLEVKPTIVDLQEKFFEIKALELARIKNKVSAEEYERMEQLSDRIIKKLLHFPITTLKQQTADTTDPVSFIRNIFDLKEQEEEFPGLTFPINLKEQNNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Length
437 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.491 kDa
Sequence
MFILTMGLNHHTAPIDIREKLVFKETEEEMALITLLQEKSILENVIISTCNRTEIVAVVDQIHTGRYYLKRFMANWFQMDMEKIEPYLFFHEEKEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTGTTGTLLNKLFREVVTFAKKVHHQTKINENAVSVSYAAVEVAKKLYGSLENKKIVLVGAGEMSELALQNLAGSGIADITIINRTKANAEILADQFQAKVGTYEEMNNYLSIADIVLVSTSADEPIIKQKDMQILMSQKSTSMLVIDIGLPRNVEHDCSYIPNFHLYDIDDLAGVVSANSLERQKIVLALENTIETEVQNFFEWEKQLGVVPVIRALREKALEMQEITMTSLENKLPGLTEREYIQIGKHMKSIINQMLKQPISELKEMSVENDAPTSIEHFKRIFGLTELDITLSEKTQEQAETRS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain CC9311)
Length
437 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.247 kDa
Sequence
MHIAVVGLSHRTAPVEVREKLSIPEQTMEESLQNLRNHEQVLEASILSTCNRLEIYTLVRNPDLGIAAVRDFLSGHSGLESRDLSPHLFTYHHDEAIAHLMRVTAGLDSLVLGEGQILSQVKKMMRLGQEHKSIGPILNRLLTQAVSTGKRVRSETNLSTGAVSVSSAAVELAQLKLGQSRGQDALVTLETEQIAVVGAGRMSRLLLQHLQAKGASGVVLLNRTIERASALATDFPNLPIQCRGLDDLDQCLSTCSLVFTSTAVDDPIIDANRLNALNRRSSLRLIDIGVPRNIASDVHEVSGVESHDVDDLQEVVERNQEARQQVAREAEGLLLEEGRLFLEWWDSLEAVPTINRLRASLEEIRVEELTKALSRMGPDFSARERKVVEALTKGMINKILHTPVTQLRSPQQRSERQQALQVVEKIFDLESGAATQD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Acidovorax sp. (strain JS42)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.07 kDa
Sequence
MAVWALGINHHTAPLDLRGRFAFALDQIAPTLHGLRDSLSSASGRHPGVETAIISTCNRTEIYCAAEAPALDHTLDWLAHSGGVSPALLRSHSYSLENGLVARHAFRVASGLDSMVLGEAQILGQMKDAVRAAEGAGALGTTLNQLFQRSFAVAKEVRTSTDIGAHSISMAAAAVRLAGQLFEDLSQIRVLFVGAGEMIELCTTHFAAKNPKQISIANRTLERGEKLAARFGGDVMRLADLPDHLHEYDAVISCTASSLPIIGLGAVERSLKKRRHRPMFMVDLAVPRDIEPEVQQLQDAYLYTVDDLASVVQTAQAHRQAAVAQAEAIIDAGVQSFVHWMELRSPATQNGGVVPLIQQLNSQADEWRALEIARAKKRLAKGEDIETVLEALSRGLTQKMLHGTMAELRAGDAEARAQTAQAVSRLFLRSHSKNGL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.467 kDa
Sequence
MTILALGINHKTASVNLRSKVAFDDQKRQLAFEQIQHRALAESVVILSTCNRTELYFHNAEITPREEHEDNIAWREQCFEWFAEIHQLEHNELRECIYFKQNMESARHLMRVACGLDSLILGEPQILGQVKQAYQYSENFYQSQNSHISTKLSRLFQRTFSTAKRVRSETEIGSSAVSVAYAACGLARQIFDNFGKLRFLLVGAGETIELVARYLIQHGAKNIMIANRTPQRAETLAERLNTPMQILSLSALQIGLNQADIVISSTGSPDMLISKEMVEIAQKQRQFDPMLLIDIAVPRDIDENAGELDAVYSYSVDDLQHIIQRNMAQREQAAEQAAQIVDEECKAFFEWLKQQQSSDLIKRYRQDAEQTRQELLAKALVALTSGQDSEKVLNELSYKLTNSLLHVPTQALQAMAKSGNSQGLQSFSKALKLEEQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.451 kDa
Sequence
MTILALGINHKTASVNLRSKVAFDDQKRQLAFEQIQHRALAESVVILSTCNRTELYFHNAEITPREEHEDNIAWREQCFEWFAEIHQLEHNELRECIYFKQNMEAARHLMRVACGLDSLILGEPQILGQVKQAYQYSENFYQSQNSHISTKLSRLFQRTFSTAKRVRSETEIGSSAVSVAYAACGLARQIFDNFGKLRFLLVGAGETIELVARYLIQHGAKNIMIANRTPQRAETLAERLNTPMQILSLSALQIGLNQADIVISSTGSPDMLISKEMVEIAQKQRQFDPMLLIDIAVPRDIDENAGELDAVYSYSVDDLQHIIQRNMAQREQAAEQAAQIVDEECKAFFEWLKQQQSSDLIKRYRQDAEQTRQELLAKALVALTSGQDSEKVLNELSYKLTNSLLHVPTQALQAMAKSGNSQGLQSFSKALKLEEQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.451 kDa
Sequence
MTILALGINHKTASVNLRSKVAFDDQKRQLAFEQIQHRALAESVVILSTCNRTELYFHNAEITPREEHEDNIAWREQCFEWFAEIHQLEHNELRECIYFKQNMEAARHLMRVACGLDSLILGEPQILGQVKQAYQYSENFYQSQNSHISTKLSRLFQRTFSTAKRVRSETEIGSSAVSVAYAACGLARQIFDNFGKLRFLLVGAGETIELVARYLIQHGAKNIMIANRTPQRAETLAERLNTPMQILSLSALQIGLNQADIVISSTGSPDMLISKEMVEIAQKQRQFDPMLLIDIAVPRDIDENAGELDAVYSYSVDDLQHIIQRNMAQREQAAEQAAQIVDEECKAFFEWLKQQQSSDLIKRYRQDAEQTRQELLAKALVALTSGQDSEKVLNELSYKLTNSLLHVPTQALQAMAKSGNSQGLQSFSKALKLEEQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9313)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.148 kDa
Sequence
MHIAVVGLSHRTAPVEIREKLSIPEQTMETSLQTLRGNDQILEVSILSTCNRLEIYTLVRHPERGISAISDFLGQHSGLATEDLSPHLFNFHHDEAVAHLMRVAAGLDSLVLGEGQILSQVKKMVRLGQEHKSMGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQAQGEDQLMTLESELVAVVGAGRMSRLLLQHLQAKGCSGVMLLNRTRQRAEDLSADFPELPVECRPLDDLNHCLSTCSLVFTSTAADDPIVDASLLKQLKRRSFLRLIDIGVPRNIASDVVDVPGVESHDVDDLHEVVSRNQEARQQMAKEAEVVLQEETRLFLEWWDSLEAVPTINRLRATLEAIRAEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTQLRAPQARPERQQALRVVASLFELDPPLENG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain AS9601)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.927 kDa
Sequence
MHIVVVGLSHRTAPVEVREKLSIPDQSITESLKALKAFSDVLEVSILSTCNRMEIYALVKDKNTGISSIKEFISEYSGIIFEDLNPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSVSTGKKVRSETNLGTGAVSISSAAVELAQLKIGQEKGFDTLVSLESENVLVVGAGRMSRLLITHLKSKGCHKLILLNRNIDRALNLAQDFPDLEIVCRGLNELEENISLSSIVFTSTASEEPIIDLAKIEKLNLSNRLKFIDIGVPRNISNDVKQHQFVKSFDVDDLQEVVSRNQEFRQKIAKEAESLVEEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQVSLKIVEKLFSLVEEEQNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.747 kDa
Sequence
MNIIVVGLSHKTAPVEVRERVAFSPNLIERPLRELVSLDDISEGVIVSTCNRVEIYATTHDIAGGTARIKRFLADHHRIPLESLEQYLYSYHSEAAIRHVFRVASSLDSMVVGEPQILGQIKTAYGYAAEYRTSGTILNRFLHKAFSVAKRVRTETRIASSAVSVAFAAVELARKILGDLSGKTVMLIGAGEMCELAAKHFLTSGARGLLVANRTFAKGERLAAEFGGEAIPFEELFQELHRADIVLSSTGAPHTIIAPRDVEAVVKRRKFKPMFFIDIAVPRDIDPRVNDLESAYLFTVDDLQEIVEANMAQRNQEASKGEEIVEQEIGQFHCWLSSLESTPTIVALRARFEEIRRAELEKTLCGWKDLSPEAEKRLEIMTLSIMNKLLHTPTAVLKRAGQGGRTDLYTDALRQLFDLQTSRQDDDELELELEEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9301)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.897 kDa
Sequence
MHIVVVGLSHRTAPVEVREKLSIPDQSITESLKALKAFSDVLEVSILSTCNRLEIYALVKDKNTGISSIKEFISEYSGIIFDDLNPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSVSTGKKVRSETNLGTGAVSISSAAVELAQLKIGQEKGFDNLVSLESENVLVVGAGRMSRLLITHLKSKGCHKLILLNRNIDRALNLAQDFPDLEIVCKGLNELEENISLSSLVFTSTASEEPIIDLTKIEKINLSNRLKFIDIGVPRNISNDVKQHEFVKSFDVDDLQEVVSRNQEFRQKIAKEAESLVEEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQVSLKIVEKLFSLVEEDKNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9215)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.79 kDa
Sequence
MHIVVVGVSHRTAPVEVREKLSIPDHSITESLKALKAFSEVLEVSILSTCNRLEIYALAKDKNTGISSIKEFLSEYSGIIFEDLDPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSVSTGKKVRSETNLGTGAVSISSAAVELAQLKIGQEKGFDTLVSLESENVLVVGAGRMSRLLITHLKSKGCHKLILVNRNIDRALNLAQDFPDLKIVCRGLNELDENISISSLVFTSTASEVPIIDLAKIEKLNLNNKLKFIDIGVPRNISNDVKQHEFVKSFDVDDLQEVVSRNQEFRQKIAKEAESLVEEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQVSLKIVEKLFSLAEEDKNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9303)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.166 kDa
Sequence
MHIAVVGLSHRTAPVEIREKLSIPEQTMETSLQTLRGNDQVLEVSILSTCNRLEIYTLVRHPERGISAISDFLGQHSGLAAEDLSPHLFNFHHDEAVAHLMRVAAGLDSLVLGEGQILSQVKKMVRLGQEHKSMGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQAQGEDQLMTLESELVAVVGAGRMSRLLLQHLQAKGCSGVMLLNRTRQRAEDLSADFPELPVECRPLDDLNHCLSTCSLVFTSTAADDPIVDASLLKQLKRRSFLRLIDIGVPRNIASDVVDLPGVESHDVDDLHEVVSRNQEARQQMAKEAEVVLQEETRLFLEWWDSLEAVPTINRLRATLEAIRAEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTQLRAPQARQERQQALRVVACLFELDPPLEDG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9312)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.723 kDa
Sequence
MHIVVVGLSHRTAPVEVREKLSIPDQSITKSLKALKAFSEVLEVSILSTCNRLEIYALVKDKNTGISSIKEFISDYSGIIFEDLNPHLFCFRQEDAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSVSTGKKVRSETNLGTGAVSISSAAVELAQLKIGQEKGFDTLVSLESEKVLVVGAGRMSRLLITHLKAKGCHKLILVNRNIDRALNLAIDFPDIEIVCKGLNELDENISISSLVFTSTASEEPIIDLAKIEKLNLNNKLKFIDIGVPRNISNDVKNHQFVKSFDVDDLQEVVSRNQEFRQKIAKEAESLVEEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQASLKIVEKLFSLVDEDKNS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.96 kDa
Sequence
MHYLIVSYSHKNTDIATRERLAFDNGVRSESFLRELVANKFINEGILLSTCNRVEFILSVKEAHKAGDFLMEKLSEYSKIPKEELSERADVYEDTGAIHHLFCVCSSLDSLVVGETQIAGQLKSAFKFAYDGGFCSQKLSRAMHFAFKCAASVRNCTEISKNPVSVASASVSKAKDILGDLGGDTAIVVGLGEMSQLTIKHLTALGCNVILVNRDKAKAEAFAKEFGGMVSVEGFPRLGELLNHHKMLFSATGAPHTVISKDMVEPKSFRRYWFDLAVPRDIEAFESETIRIFAVDDLQEIVNKNLSLREEQAKRAYGIIGRFTQEFYKWLQSLSVDPIIKAMREQAKEAALKEITKAISKGYLPKECEKSVEKIIHNSFNTFLHHPTIKLKEISEEPQSDTVVEAVKLLFGIQEDGLMLDRYKCEYDTTSKEREE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.747 kDa
Sequence
MNIIVVGLSHKTAPVEVRERVAFSPNLIERPLRELVSLDDISEGVIVSTCNRVEIYATTHDIAGGTARIKRFLADHHRIPLESLEQYLYSYHSEAAIRHVFRVASSLDSMVVGEPQILGQIKTAYGYAAEYRTSGTILNRFLHKAFSVAKRVRTETRIASSAVSVAFAAVELARKILGDLSGKTVMLIGAGEMCELAAKHFLTSGARGLLVANRTFAKGERLAAEFGGEAIPFEELFQELHRADIVLSSTGAPHTIIAPRDVEAVVKRRKFKPMFFIDIAVPRDIDPRVNDLESAYLFTVDDLQEIVEANMAQRNQEASKGEEIVEQEIGQFHCWLSSLESTPTIVALRARFEEIRRAELEKTLCGWKDLSPEAEKRLEIMTLSIMNKLLHTPTAVLKRAGQGGRTDLYTDALRQLFDLQTSRQDDDELELELEEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9301)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.897 kDa
Sequence
MHIVVVGLSHRTAPVEVREKLSIPDQSITESLKALKAFSDVLEVSILSTCNRLEIYALVKDKNTGISSIKEFISEYSGIIFDDLNPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSVSTGKKVRSETNLGTGAVSISSAAVELAQLKIGQEKGFDNLVSLESENVLVVGAGRMSRLLITHLKSKGCHKLILLNRNIDRALNLAQDFPDLEIVCKGLNELEENISLSSLVFTSTASEEPIIDLTKIEKINLSNRLKFIDIGVPRNISNDVKQHEFVKSFDVDDLQEVVSRNQEFRQKIAKEAESLVEEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQVSLKIVEKLFSLVEEDKNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9215)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.79 kDa
Sequence
MHIVVVGVSHRTAPVEVREKLSIPDHSITESLKALKAFSEVLEVSILSTCNRLEIYALAKDKNTGISSIKEFLSEYSGIIFEDLDPHLFCFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSVSTGKKVRSETNLGTGAVSISSAAVELAQLKIGQEKGFDTLVSLESENVLVVGAGRMSRLLITHLKSKGCHKLILVNRNIDRALNLAQDFPDLKIVCRGLNELDENISISSLVFTSTASEVPIIDLAKIEKLNLNNKLKFIDIGVPRNISNDVKQHEFVKSFDVDDLQEVVSRNQEFRQKIAKEAESLVEEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQVSLKIVEKLFSLAEEDKNN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9303)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.166 kDa
Sequence
MHIAVVGLSHRTAPVEIREKLSIPEQTMETSLQTLRGNDQVLEVSILSTCNRLEIYTLVRHPERGISAISDFLGQHSGLAAEDLSPHLFNFHHDEAVAHLMRVAAGLDSLVLGEGQILSQVKKMVRLGQEHKSMGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQAQGEDQLMTLESELVAVVGAGRMSRLLLQHLQAKGCSGVMLLNRTRQRAEDLSADFPELPVECRPLDDLNHCLSTCSLVFTSTAADDPIVDASLLKQLKRRSFLRLIDIGVPRNIASDVVDLPGVESHDVDDLHEVVSRNQEARQQMAKEAEVVLQEETRLFLEWWDSLEAVPTINRLRATLEAIRAEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTQLRAPQARQERQQALRVVACLFELDPPLEDG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9312)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.723 kDa
Sequence
MHIVVVGLSHRTAPVEVREKLSIPDQSITKSLKALKAFSEVLEVSILSTCNRLEIYALVKDKNTGISSIKEFISDYSGIIFEDLNPHLFCFRQEDAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLTQSVSTGKKVRSETNLGTGAVSISSAAVELAQLKIGQEKGFDTLVSLESEKVLVVGAGRMSRLLITHLKAKGCHKLILVNRNIDRALNLAIDFPDIEIVCKGLNELDENISISSLVFTSTASEEPIIDLAKIEKLNLNNKLKFIDIGVPRNISNDVKNHQFVKSFDVDDLQEVVSRNQEFRQKIAKEAESLVEEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQASLKIVEKLFSLVDEDKNS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.96 kDa
Sequence
MHYLIVSYSHKNTDIATRERLAFDNGVRSESFLRELVANKFINEGILLSTCNRVEFILSVKEAHKAGDFLMEKLSEYSKIPKEELSERADVYEDTGAIHHLFCVCSSLDSLVVGETQIAGQLKSAFKFAYDGGFCSQKLSRAMHFAFKCAASVRNCTEISKNPVSVASASVSKAKDILGDLGGDTAIVVGLGEMSQLTIKHLTALGCNVILVNRDKAKAEAFAKEFGGMVSVEGFPRLGELLNHHKMLFSATGAPHTVISKDMVEPKSFRRYWFDLAVPRDIEAFESETIRIFAVDDLQEIVNKNLSLREEQAKRAYGIIGRFTQEFYKWLQSLSVDPIIKAMREQAKEAALKEITKAISKGYLPKECEKSVEKIIHNSFNTFLHHPTIKLKEISEEPQSDTVVEAVKLLFGIQEDGLMLDRYKCEYDTTSKEREE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.45 kDa
Sequence
MNGNTGVVSGVRVSHETASLDELAAASAASTEAALDALLEQPPVEEAFVLQTCHRVEAYVVTADQASGRRALGGAGFNPAGGGAISMGHEDSLRHLLRVAAGLESLVVGEDQILGQLRDAYDAAKDAGGIDHVLREAVTKAMHVGERARTETAINEGATSLGTAAVRLAERKTQLADARAVVVGAGEMGALAAKAFASATVAEIVIANRTPARAVRVADMVSVPAEATTLADARGRLDAADVVVTATGSPEHVLPASAFADAGDTVVVDLAQPRDVAPGAGGHDGVAVHDLDDLEAVTAATRERREDAAREVEAMIETEFERLLTQYKRKRADEVIARMYESADRLKSREVQTAVHRLEAESGSLSADEREVVESMADALVSQLLAAPTKSLRDAAAEDDWSTIATALELFNPEFEDGMPFDASRGGDAASAESED

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Length
436 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.45 kDa
Sequence
MNGNTGVVSGVRVSHETASLDELAAASAASTEAALDALLEQPPVEEAFVLQTCHRVEAYVVTADQASGRRALGGAGFNPAGGGAISMGHEDSLRHLLRVAAGLESLVVGEDQILGQLRDAYDAAKDAGGIDHVLREAVTKAMHVGERARTETAINEGATSLGTAAVRLAERKTQLADARAVVVGAGEMGALAAKAFASATVAEIVIANRTPARAVRVADMVSVPAEATTLADARGRLDAADVVVTATGSPEHVLPASAFADAGDTVVVDLAQPRDVAPGAGGHDGVAVHDLDDLEAVTAATRERREDAAREVEAMIETEFERLLTQYKRKRADEVIARMYESADRLKSREVQTAVHRLEAESGSLSADEREVVESMADALVSQLLAAPTKSLRDAAAEDDWSTIATALELFNPEFEDGMPFDASRGGDAASAESED

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / 130Z)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.073 kDa
Sequence
MTILVLGINHKTATVALREKVAFSEEKRLSALNQIEQLKLAQSTVILSTCNRTEVYLHNKFIQPEQNSAWIDECVAWFAAIHQIQLTDLQDCLYFYQNQQAVTHLMRVACGLDSLILGEPQILGQVKQAYQLAEEYYQRAHGLGKSAVISSELSRLFQKTFSTAKRVRTETNIGESAVSVAYAACSLGRQIFESLQELTILLVGAGETIELAARHLLRHGVKKLMIANRTRARAEALVAKLESPFIEILSLSELQDGLNQADIVISSTGSPTTLISYEMMKQAQIQRRYRPVLIVDIAVPRDVEESIVKLDSVYHYTVDDLQNIINHNLSEREKASEQAEEIIAEECAAFFEWLKVRQASNLIRTYRESADEIRQELLEKAQFSLSQGESADKILDEFSTKLMNKLLHSPTLVMQTMVKQGDSRGLQNFLSVIKK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9211)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.959 kDa
Sequence
MNIAVVGLSHRTAPVEVREKLSISDDNIPSAFNTLNTNDQIIEVSILSTCNRLEIYSFVKNSDNGVKAIKDFLCKHSGLGIDELDPHLFSYDQAEAVKHVMRVAGGLDSLVLGEGQILSQVKKMVRLGQENHSMGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQSEGKDELMSLEREKVSIVGAGRMSRLLIQHLQSKGCSKLKLINRTFQRAEALALDFPDVDIHCQLLDDLDESLRNSTLIFTSTAAENPIIDAARLKEVVRDETLRLIDIGVPRNISSDVKGLTGFEAHDVDDLQEVVSRNQEARQQIALEAEALVDEEGRIFLEWWASLEAVPTINLLRSSLESVRKEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTNLRAPQTSSNRKISLEVIETLFELGVSESE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9515)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.515 kDa
Sequence
MQIVVVGLSHRTAPVEVREKLSIPDQAISESLKSLRAYSDILEVSILSTCNRLEIYGLVKDKNIGISSIKEFLSDYSQVNCEVLTPHLFDFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLSQSVSAGKKVRAETNLGTGAVSISSAAVELAQLKIGQDNGIDGLVSLKGEKVLVVGAGRMSRLLITHLKSKGCNKLTLLNRNIDRAINLSGDFPDIEIICKGLDELDKSITLSSLVFTSTASEKPFIDLERIKNISLNNKLKFIDIGVPRNISNDVKQHDLIEAFDVDDLEEVVSRNQEFRQKIAKEAESLVKEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQASLKIVEKLFSLMDDEQK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9211)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.959 kDa
Sequence
MNIAVVGLSHRTAPVEVREKLSISDDNIPSAFNTLNTNDQIIEVSILSTCNRLEIYSFVKNSDNGVKAIKDFLCKHSGLGIDELDPHLFSYDQAEAVKHVMRVAGGLDSLVLGEGQILSQVKKMVRLGQENHSMGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQSEGKDELMSLEREKVSIVGAGRMSRLLIQHLQSKGCSKLKLINRTFQRAEALALDFPDVDIHCQLLDDLDESLRNSTLIFTSTAAENPIIDAARLKEVVRDETLRLIDIGVPRNISSDVKGLTGFEAHDVDDLQEVVSRNQEARQQIALEAEALVDEEGRIFLEWWASLEAVPTINLLRSSLESVRKEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTNLRAPQTSSNRKISLEVIETLFELGVSESE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus (strain MIT 9515)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.515 kDa
Sequence
MQIVVVGLSHRTAPVEVREKLSIPDQAISESLKSLRAYSDILEVSILSTCNRLEIYGLVKDKNIGISSIKEFLSDYSQVNCEVLTPHLFDFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLSQSVSAGKKVRAETNLGTGAVSISSAAVELAQLKIGQDNGIDGLVSLKGEKVLVVGAGRMSRLLITHLKSKGCNKLTLLNRNIDRAINLSGDFPDIEIICKGLDELDKSITLSSLVFTSTASEKPFIDLERIKNISLNNKLKFIDIGVPRNISNDVKQHDLIEAFDVDDLEEVVSRNQEFRQKIAKEAESLVKEERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQASLKIVEKLFSLMDDEQK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.314 kDa
Sequence
MHYYCISFTHKNTDIATREKLSFSNEDKKRELLKLIHTNNKILESLVLSTCNRVEIFLFVGDVESINEHILKTLSLLCGVDRENLSTKADFYEDSGAIHHLFSVASSLDSLVIGETQIAGQLKDAYKFALQEQRCGVHLTRAVHYAFKCAANVRNQTEISKNPISVASVAVAKAKELVNLENKTAVVVGAGEMSELACKHLLNAKAKVLILNRDIQNAQKLCEDLGENASYESIANLKEALNQYEIFFSATNAPHAIITNDLLEEKDYSRYFFDIAVPRDIDVKANEKNIVYAVDDLEEVVRKNLTLREHQAQIAYSIVGTMTNEFFQHLSKLATLPLVKQLRLQADEIAKEQLQKAIDKGYLKHSNHEEARKLIRQVMNAFLHHPSVNLKKLSGTMQNDSVINAMRYVFDLKNENMEGLNLYKCEFNLENNHEI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfurovum sp. (strain NBC37-1)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.507 kDa
Sequence
MYYQIVSFSHKNCEQSMREKLAFPNDEEKATFLEQLTGFEFVHEAFIISTCNRVEIVMATRDNFSSYHAVLGLMSQKGGLNFYELKSTAKRYDDEEAIEHIFSVVSSLDSLVIGESQITGQVKEAFRFSFQHGTAGRRLNRVLSYAVKCAAEVRNATNISQNPISIASVAVAQAHKLLGDNIQGMKGIVVGAGDMGVLAAKHLLRVGCDVVLIGRDLDKVQTVADSLGEDVKADTMENLTKYINRYRLLFSATSSPEPVITGDLIENETLPRQWFDMAIPRDIEDMELEKLQLFRIDDLRAISNDNHAMREEQAVRANEIVERYTEEFYAWLKALSIEPVIKQMRQHVSAAIEKEMQRALKKGFVPKEYESNMRKMAEQMFNRFLHDPTQNLRASSTESKNTNCIESVKKMFNIDTEHVDFKQYKNDHHTKGYSA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Ralstonia solanacearum (strain GMI1000)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.753 kDa
Sequence
MQLLTLGINHHTAPLSLREKVAFPLEQLKPALGTLRQHLPHRKSTAEAAILSTCNRTELYCATDGNLPEDTAHEHAIRWLAHHHNIDAGELAPHVYALGQSQAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGAHSVSMAAAAVRLAQRIFESIAEQRVLFIGAGEMIELCATHFAAQKPRETVVANRTLERGEKLAEALSNQGLNARAVRLAELPARLGEFDIVVSCTASTLPIIGLGAVERAIKQRRHRPMFMVDLAVPRDIEPEVARLSDVFLYTVDDLGAIVREGNALRQAAVAQAEAIIETRVQNFMHWLDARSVVPIIRDLHAHAEALRQGELERAQRMLARGDDPALVLEALSQALTKKFLHGPTHALNHAQGEGREQLIDLLPGLFRQSSHSER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.228 kDa
Sequence
MFILTMGLNHHTAPIDIREKLVFKETEEEMALVTLLQEKSILENVIISTCNRTEIVAVVDQIHTGRYYLKRFMANWFQMDMEKIEPYLFFHEEAEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTGTTGTLLNKLFREVVTFAKKVHHHTKINENAVSVSYAAVEVAKKLYGSLDNKKIVLIGAGEMSELALQNLAGSGIADITIINRTKSNAEILAHQFQAKVGAYENMSDHLLEADIVLVSTSAEEPIIKQVAMQELMEQKASSMLVIDIGLPRNVEHDCSYIPNFHLYDIDDLAGVVSANSLERQRIVQELENTIETEVRSFFEWEKQLGVVPVIRALREKALDMQEVTMTSLENKLPGLTEREYIQIGKHMKSIINQMLKQPISELKEMSVEENADTSIEHFKRIFGLTETDVAIIEKEQAETRS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Listeria monocytogenes serotype 4b (strain CLIP80459)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.15 kDa
Sequence
MFILTMGLNHHTAPIDIREKLVFKESEEEMALVTLQQEKSILENVIISTCNRTEIIAVVDQIHTGRYYLKRFMANWFQMDMEKIEPYLFFHEESDAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTATTGTLLNKLFREVVTFAKKVHHHTKINENAVSVSYAAVEVAKKLYGSLDNKKIVLVGAGEMSELALQNLAGSGIADITIINRTKSNAELLANQFQAKVGAYENMNEHLMLADIVLVSTSAAEPIIKQAAMQDLMEQKASSMLVIDIGLPRNVEHDCSYIPNFHLYDIDDLAGVVSANSLERQRIVLELEKTIEAEVRNFFEWEKQLGVVPVIRALREKALDMQEVTMTSLENKLPGLTEREYIQIGKHMKSIINQMLKQPISELKEMSVEEDATTSIEHFKRIFGLSETDVTVIEKEQAETRS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Listeria monocytogenes serotype 4b (strain F2365)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.136 kDa
Sequence
MFILTMGLNHHTAPIDIREKLVFKESEEEMALVTLQQEKSILENVIISTCNRTEIVAVVDQIHTGRYYLKRFMANWFQMDMEKIEPYLFFHEETDAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTATTGTLLNKLFREVVTFAKKVHHHTKINENAVSVSYAAVEVAKKLYGSLDNKKIVLVGAGEMSELALQNLAGSGIADITIINRTKSNAELLANQFQAKVGAYENMNEHLMLADIVLVSTSAAEPIIKQAAMQDLMEQKASSMLVIDIGLPRNVEHDCSYIPNFHLYDIDDLAGVVSANSLERQRIVLELENTIEAEVRNFFEWEKQLGVVPVIRALREKALDMQEVTMTSLENKLPGLTEREYIQIGKHMKSIINQMLKQPISELKEMSVEEDATTSIEHFKRIFGLSETDVTVIEKEQAETRS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Listeria monocytogenes serotype 4a (strain HCC23)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.252 kDa
Sequence
MFILTMGLNHHTAPIDIREKLVFKETEEEMALVTLQQEKSILENVIISTCNRTEIVAVVDQIHTGRYYLKRFMANWFQMDMEKIEPYLFFHEESEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTATTGTLLNKLFREVVTFAKKVHHHTKINENAVSVSYAAVEVAKKLYGSLDNKKIVLIGAGEMSELALQNLAGSGMTDITIINRTKTNAELLANQFQAKVGAYENMNEHLLLADIVLVSTSAAEPIIKQAAMQELMEQKASSMLVIDIGLPRNVEHDCSYIPNFHLYDIDDLAGVVTANSIERQQIVLELEDTIESEVRNFFEWEKQLGVVPVIRALREKALDMQEVTMTSLENKLPGLTEREYIQIGKHMKSIINQMLKQPISELKEMSVEEDATTSIEHFKRIFGLTKTDVTIIEKEQAETRS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.25 kDa
Sequence
MFILTMGLNHHTAPIDIREKLVFKETEEEMALVTLQQEKSILENVIISTCNRTEIVAVVDQIHTGRYYLKRFMANWFQMDMEKIEPYLFFHEETEAVNHLYKVTAGLDSLVLGETQILGQVKHAFEIAKQTETTGTLLNKLFREVVTFAKKVHHHTKINENAVSVSYAAVEVAKKLYGSLDNKKIVLVGAGEMSELALQNLAGSGIADITIINRTKSNAELLANQFQAKVGAYENMNEHLMLADIVLVSTSATEPIIKQAAMQDLMEQKASSMLVIDIGLPRNVEHDCSYIPNFHLYDIDDLAGVVSANSLERQRIVLELENTIEVEVRNFFEWEKQLGVVPVIRALREKALDMQEVAMTSLENKLPGLTEREYIQIGKHMKSIINQMLKQPISELKEMSVEEDATTSIEHFKRIFGLSETDVTVIEKEQAETRS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Haemophilus parasuis serovar 5 (strain SH0165)
Length
435 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.238 kDa
Sequence
MTILALGINHKTASVSLREKVAFVEDKRQRAFEQIRDQSLAESVVILSTCNRTELYFHQPKIPPQEEHPDNIAWREQCFNWFAEIHQLDKEELSEAYYFKQNLEAARHLMSVACGLDSLILGEPQILGQVKQAYQESEEFYHSQGSGVSTNLSRLFQKTFATAKRVRSETEIGSSAVSVAYAACGLARQIFDDFTKLRFLLVGAGETIELVARHLINHGAKNIMIANRTHIRAEMLAVKLDIPMQILSLSALQIGLNQADVVICSTGSPDILITKEMVEQAQKQRRFDPMLLIDIAVPRDIDEKAGELDSIYAYSVDDLQNIIQQNIAQRQQAAEQAKEIVIEEAKDFFVWLKQQQSTNLIKHYRQNAEEIRLDLLEKALSALQQGQDCEKVLNELSYKLTNQLLHIPTQALQAMAKNSNVKGLQSFSKALKLEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.578 kDa
Sequence
MQLLAIGINHTTAPVSLRERVAFPLEQIKPALGALRTHLSGRNGTEAAILSTCNRTEIYCATDVLKPGEEGFEHTLRWLAQHHNVPASELAPHLYALPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGALGTYLNQLFQRTFAVAKEVRGQTEIGAHSVSMAAAAVRLAQRIFESVSTQRVLFIGAGEMIELCATHFAAQTPRQIVVANRTVERGEKLAEQLSEQGLTTQAIRLQDLGDRLHEFDIVVSCTASSLPIIGLGAVERAVKRRKHRPIMMVDLAVPRDVEPEVARLDDVFLYTVDDLGAVVREGNALRQAAVAQAEAIIDSRVLNFMHWLETRSVVPVIRELQSQGEAIRQAEVERARRMLARGDDPAAVLEALSGALTRKFLHGPTHALNHTQGEDREALLRLVPGLFRHSSHSER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.474 kDa
Sequence
MQLLAIGINHTTAPVSLRERVAFPLEQIKPALGALRSHLSGRSGTEAAILSTCNRTEIYCATDVLTPGTDGFEHTLRWLSQHHNVPAGELAPHLYALPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGSLGTYLNQLFQRTFAVAKEVRGQTEIGAHSVSMAAAAVRLAQRIFESVSTQRVLFIGAGEMIELCATHFAAQQPRQIVVANRTVERGEKLAEQLSGQGLTANAIRLTDLGERLHEFDIVVSCTASSLPIIGLGAVERAVKRRKHRPIMMVDLAVPRDVEPEVARLDDVFLYTVDDLGAIVREGNAMRQAAVAQAEAIIESRVQNFMHWLETRSVVPVIRELQTSGEAIRQAELERARRMLARGDDPEAVLEALSGALTRKFLHGPTHALNHTQGEDREALLRLVPGLFRHSSHSER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cupriavidus necator (strain JMP 134 / LMG 1197)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.659 kDa
Sequence
MQLLAIGINHTTAPVSLRERVAFPLEQIKPALGALRTHLAGRNGTEAAILSTCNRTEIYCATDILKPGAEGFEHTLRWLSQHHNVPASDLAPHLYSLPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGSLGTYLNQLFQRTFAVAKEVRGQTEIGAHSVSMAAAAVRLAQRIFESVSTQRVLFIGAGEMIELCATHFAAQKPRQVVVANRTVERGEKLAEQLAEQGLTTQAIRLQELGERLHEFDIVVSCTASSLPIIGLGAVERAVKRRKHRPIMMVDLAVPRDVEPEVARLDDVFLYTVDDLGAVVREGNALRQAAVAQAEAIIESRVQNFMHWLETRSVVPVIRELQTAGESIRQAELERARRMLARGDDPEAVLEALSGALTRKFLHGPTHALNHMQGEDREALVRLVPGLFRQSSHSER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.578 kDa
Sequence
MQLLAIGINHTTAPVSLRERVAFPLEQIKPALGALRTHLSGRNGTEAAILSTCNRTEIYCATDVLKPGEEGFEHTLRWLAQHHNVPASELAPHLYALPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGALGTYLNQLFQRTFAVAKEVRGQTEIGAHSVSMAAAAVRLAQRIFESVSTQRVLFIGAGEMIELCATHFAAQTPRQIVVANRTVERGEKLAEQLSEQGLTTQAIRLQDLGDRLHEFDIVVSCTASSLPIIGLGAVERAVKRRKHRPIMMVDLAVPRDVEPEVARLDDVFLYTVDDLGAVVREGNALRQAAVAQAEAIIDSRVLNFMHWLETRSVVPVIRELQSQGEAIRQAEVERARRMLARGDDPAAVLEALSGALTRKFLHGPTHALNHTQGEDREALLRLVPGLFRHSSHSER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.474 kDa
Sequence
MQLLAIGINHTTAPVSLRERVAFPLEQIKPALGALRSHLSGRSGTEAAILSTCNRTEIYCATDVLTPGTDGFEHTLRWLSQHHNVPAGELAPHLYALPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGSLGTYLNQLFQRTFAVAKEVRGQTEIGAHSVSMAAAAVRLAQRIFESVSTQRVLFIGAGEMIELCATHFAAQQPRQIVVANRTVERGEKLAEQLSGQGLTANAIRLTDLGERLHEFDIVVSCTASSLPIIGLGAVERAVKRRKHRPIMMVDLAVPRDVEPEVARLDDVFLYTVDDLGAIVREGNAMRQAAVAQAEAIIESRVQNFMHWLETRSVVPVIRELQTSGEAIRQAELERARRMLARGDDPEAVLEALSGALTRKFLHGPTHALNHTQGEDREALLRLVPGLFRHSSHSER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cupriavidus necator (strain JMP 134 / LMG 1197)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.659 kDa
Sequence
MQLLAIGINHTTAPVSLRERVAFPLEQIKPALGALRTHLAGRNGTEAAILSTCNRTEIYCATDILKPGAEGFEHTLRWLSQHHNVPASDLAPHLYSLPQSEAVRHAFRVASGLDSMVLGETQILGQLKDAVRTAGEAGSLGTYLNQLFQRTFAVAKEVRGQTEIGAHSVSMAAAAVRLAQRIFESVSTQRVLFIGAGEMIELCATHFAAQKPRQVVVANRTVERGEKLAEQLAEQGLTTQAIRLQELGERLHEFDIVVSCTASSLPIIGLGAVERAVKRRKHRPIMMVDLAVPRDVEPEVARLDDVFLYTVDDLGAVVREGNALRQAAVAQAEAIIESRVQNFMHWLETRSVVPVIRELQTAGESIRQAELERARRMLARGDDPEAVLEALSGALTRKFLHGPTHALNHMQGEDREALVRLVPGLFRQSSHSER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.312 kDa
Sequence
MNLFLAGLDHTTAPVEIREQLAFSQTDLPSALMQLTSSETGTPPLFAEAVILSTCNRVELYGVTNPGTTAQHVVDFLAAFHRRPAASFVHTLYFYQGEAVARHLCATAAGLRSLVLGEAQIQGQVRNAYEAAQRIGSVGSILHRLFQIALVAGKRVRHETTIGKGAASVSQAGVELARRRLGDLRGREVLLIGGGEVSELAAQNLIANGADRLTIVNRTSARAAALAERYGAEMLDFGALPQALARADIVISSTAAPVPIIYRHHVAEAIAHKQRARACGECDPPTMLLIDLAVPRDIAADVAQIPGVHLFTVDDLREVVSHTIELRSAVLEIAQQIVEEQVQEFLSWMRTQEALPVLTMLRQRAEEVRNEELARALRRLHDLSPEQRAVIEGLSRSIVNKLLHLPTRCLREAAAHGQGKRYASILAELFNLEH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia mallei (strain NCTC 10247)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.546 kDa
Sequence
MDMQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia mallei (strain NCTC 10229)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.546 kDa
Sequence
MDMQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia mallei (strain SAVP1)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.546 kDa
Sequence
MDMQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia pseudomallei (strain 1106a)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.546 kDa
Sequence
MDMQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia pseudomallei (strain 668)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.56 kDa
Sequence
MDMQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELIVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Hydrogenovibrio crunogenus (strain XCL-2)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.324 kDa
Sequence
MKLLVLGVNHETAPVDIREKVSFSPAQVQNALSELKSQGLANESVILSTCNRTEIYTTLKSQSPEKIRAWLHEYFELEEDSINSFLYEYADIEAIKHMMRVSSGLNSLVLGEPQILGQIKEAFHLAHKSDSVHQTLHALFQYIFKTAKQVRTDTAIGSSPVSVAFSAVALSKQFFGKLENQTALLLGAGETVELVARHLKESHIGNLIIANRTLSKAHQLTESLGGYAISLHEIDDHLHEADIVIASTASPTPILKTEMVANALKKRRNKPMFMIDIAVPRDIEPAIGNFSDTYLYTVDDLQEIIEENKRSRKDAALEAEEIVELQAENFMAQYQATQQISPIIQRYRQQAYTLKEHALQDALHHLENGGDPQELLTKLANQLTNKILHTPTTNLHHAGLNGQKEVIQAAEQILLTQQSDASDSSENENTHATS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.493 kDa
Sequence
MNIIVVGLSHKTAAVEIREKVAFAPTQMEKPLQAVVALPDITEAVIVSTCNRVEIYATTRDVAGGMARIKRFLADYHNVPLELLEKHLYSYHGEDATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAFSVAKRVRTETKIASSAVSVAFAAVELAKKIFGELSDKTVLLIGAGEMCELAAKHFINTGVRGVMVTNRTYERAEKLAEEFDAKPVHFEALMETLPKADIILSSTGAPHFIIHEKDMEEVLRRRKHKPMFFIDIAVPRDIDPKVNNVENCYLYTVDDLNGVVATNLEQRKVEAAKAEAIVEQEIGQFFKWLSSLEVTPTIVALRTHFDEIRKAELSKTISGWKDLPPGAEKKLDALTNAIMNKLLHQPTSVLKRIDQGNRNDLYVDALRNLFDLEVGGESQDNMMELED

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.728 kDa
Sequence
MNIIVVGLSHKTAAVEIREKVAFSPTQMEKPLHALVSIPDITEGVIVSTCNRVEIYATTRDIAGGIARLKRFLADYHNFPLETLEPHLYSYHGEAATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAFSVAKRVRTETKIASSAVSVAFAAVELAKKIFGDLSDKTVMLIGAGEMCELAAKHFINTGVRGVMVTNRTFERAVKLAEEFDGKAVNYEDLFDQLHKADIILSSTGAPHFIIKPKDIEDVIRRRKLKPMFFIDIAVPRDIDPKVNDIENIYLYTVDDLNGVVATNLEQRKKESEKAEAIVEQEIGQFFKWLSSLEVTPTIVALRSKFDEIRRAELAKTMANWKDLPPEGEKRLEALTNAIMNKLLHQPTSVLKRSDQGNRNDLYVDALRNLFDLETAPHEEMELGELEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.472 kDa
Sequence
MNIIVVGLSHKTASVDIREKVAFSPNSIEKPLHELVNLDGIVEGIIVSTCNRVEIYATTRDIAGGIARIRRFMAEYHHLAHDLLEPHLYSYHGEEAIRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAFSVAKRVRTETRIASSAVSVSFAAVELARKIFGNLTDKTVLLIGAGEMCELAARHFLTNGAKGVMVTNRTFERAQRLAEEFGGEAIPFDELFLHLHKADIVLTSTGAPHAIITPPDLEEVIKRRRMRPMFLIDIAVPRDIDPAVNEMDAVYLYDMDDLQQVVAANLEGRKQEADKAEAIIAEEIIQFYKWVATLEVTPTIVALRNRFEELRKAELERTLAGWKDAPPDAEKRLEALTSAFMNKLLHQPTTVLKKAGQGNRTDLYLDALRALFDLELGGTDTNESLELEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.296 kDa
Sequence
MNLFLAGLDHTTAPVEIREQLAFSQTDLPSALMQLTSSETGTPPLFAEAVILSTCNRVELYGVTNPGTTAQHVVDFLAAFHRRPAASFVHTLYFYQGEAVARHLCATAAGLRSLVLGEAQIQGQVRNAYEAAQRIGSVGSILHRLFQIALVAGKRVRHETTIGKGAASVSQAGVELARRRLGDLRGREVLLIGGGEVSELAAQNLIANGADRLTIVNRTSARAAALAERYGAEMLDFGALPQALARADIVISSTAAPVPIIYRHHVAEAIAHKQRARACGECDPPTMLLIDLAVPRDIAADVAQIPGVHLFTVDDLREVVSHTIELRSAVLEIAQQIVEEQVQEFLSWMRTQEALPVLTMLRQRAEEVRNEELARALRRLHDLSPEQRAVIEGLSRSIVNKLLHPPTRCLREAAAHGQGKRYASILAELFNLEH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.227 kDa
Sequence
MNIVVVGLSHKTASVDIREKVAFAPTQMEKPLRALLAIEDIAEAVIVSTCNRVEVYISTRDIAGGMARIKRFLADYHGISPEILEPHLYAHHGEAAIRHVFRVASSLDSMVVGEPQILGQIKTAYGYAAEFKTSGIILNRFLHKAFSVAKRVRTETKIASSAVSVSFAAVELARKIFGNLSDKTVMLIGAGEMCELAAKHFINNGVRGVMVTNRTYERAVKLAEEFEGKPVSFDDLFDQLHKADIVLSSTGATQFIIKPKDVEEVIRRRKLKPMFFIDIAVPRDIDPKVNDVENVYLYDMDDLQGVVASNLQQRAEEAKKAEAIIDEEIGQFHKWLSNLEVTPTIVALRSKFEETRKAELEKTLASWKDLPPDGAKRLEALTTAIVNKLLHPPTATLKRVGQGGRTDLYVDALRTLFELQTGESEAEELGELEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.487 kDa
Sequence
MNIVVVGLSHKTASVEIREKIAFAPTQMEKPLRMLIAIDDIAEAVIVSTCNRVELYASTRDVAGGMARLKRFLGDYHGVPVEVLEPHLYSHHGEAAIRHVFRVAASLDSMVVGEPQILGQIKTAYGYAAEFRTSGIILNRFLHKAFSVAKRVRTETKIASSAVSVSFAAVELARKIFGDLSDKTVMLIGAGEMCELAAKHFLNNGARGVMVTNRTYERAERLAEEFEGKAIHFEDLFDQLHKADIVLSSTGATHYIIRPKDIDEVIRRRKMKPMFFIDIAVPRDIDPKVNDVENVYLYDMDDLQNVVASNLQQRAEEAKKAEGIIEEEIGQFYKWISSLEVTPTIVALRSKFEDVRRAELEKTLSAWKDLPPDGAKRLEALTAAIVNKLLHPPTATLKRTGQGGRTDLYVDALRTLFDLQTELPEPEGSLELEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacter sp. (strain M21)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.452 kDa
Sequence
MNIIVVGLSHKTAAVEIREKVAFAPTQMEKPLQAVVALPDITEAVIVSTCNRVEIYATTRDVAGGMARIKRFLADYHNVPLELLEKHLYSYHGEDATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAFSVAKRVRTETKIASSAVSVAFAAVELAKKIFGELSDKTVLLIGAGEMCELAAKHFINVGVRGVMVTNRTYERAEKLAEEFDAKPVHFEALMETLPKADIILSSTGAPHFIIHEKDMEDVLRRRKHKPMFFIDIAVPRDIDPKVNDVENCYLYTVDDLNGVVATNLEQRKVEAAKAEAIVEQEIGQFFKWLSSLEVTPTIVALRTHFDEIRKAELSKTVSGWKDLPPGAEKKLDALTNAIMNKLLHQPTSVLKRTDQGNRNDLYVDALRNLFDLEVGGETQDNMMDLED

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Geobacter uraniireducens (strain Rf4)
Length
434 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.621 kDa
Sequence
MNIIVVGLSHKTATVEIREKVAFAPTQMEKPLHALVSLPDITEAVIVSTCNRVEIYATTRDIAGGVARLKRFLADYHNISLETLEPHLYSYHGEAATRHVFRVASSLDSMVVGEPQILGQIKTSYGYAAEYKSSGIILNRFLHKAFSVAKRVRTETKIASSAVSVAFAAVELAKKIFGDLSDKTVMLIGAGEMCELAAKHFINTGVRGVMVTNRTFERAVKLAEEFDGKAVNYEELFDHLHKADIVLSSTGAPHFIIGPKNVEEVIRRRKMKPMFFIDIAVPRDIDPKVNDVENIYLYTVDDLNGVVATNLEQRNKEAEKAEAIVEQEIGQFFKWLSSLEVTPTIVALRSKFDEIRRAELAKTLANWKELPPDAEKRLEALTSAIMNKLLHQPTSVLKRAEQGNRNDLYIDALRNLFELETTRPEVEELGELEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Length
433 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.289 kDa
Sequence
MHIVVVGLSHRTAPVEVREKLSIPDQSISESLKTLSINSDILEVSILSTCNRLEIYALVKEINIGISSIKEFLTDYSSVNFEDLNPHLFDFRQEEAVLHLMKVSAGLDSLVLGEGQILSQVKKMMRLGQENQSTGPILNRLLSQSVSAGKKVRSETNLGTGAVSISSAAVELAQLKIGQDHGVDGLVSLKSEKVLVVGAGRMSRLLITHLKSKGCNRLTLLNRNIERAVNLAGDFPDLEINCKSLNELDKNISLSSLVFTSTASEKPFIDLARVEKISLNNKLKFIDIGVPRNISNDVKHHAFIESFDVDDLEEVVSRNQEFRQKIAKEAESLVKDERIIFLEWWASLEAVPVINKLRSDLELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSRDERQASLKIVEKLFSLVDDE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Histophilus somni (strain 2336)
Length
433 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.006 kDa
Sequence
MTILVLGINHKTASVALREKVAFSDEKRLLALKQIKQTQLAECAVILSTCNRTEVYLHNKNVGPQNDEVWLDSCVQWFADIHQVDLEELKSCLYSQQNLQASRHLMRVASGLDSLILGEPQILGQVKQAYQMSEEYYSLHSDIGMMSTELSRLFQKTFATAKRVRTETHIGESAVSVAYAACSLARQIFDSLRNLNILLVGAGETIELVSRHLLRHGVNGLAIANRTLSRAEKLVEKLETTQKIDIFSLDRLSEGLKRADIVITSTGSPHVLISRNLIEQAQQMRHYKPMLIVDIAVPRDVEESAGEIESVYHYTVDDLHNIIQHNINQREQASQQAEHIIQQESADFFEWLKVHQFSNLIRNYRESAEIIRQDLLEKALQALQNGENTEQVLQELSHKLTKKLIHQPTQAMQTMVKAGNTEGLQAFSHAVKS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Haemophilus somnus (strain 129Pt)
Length
433 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.076 kDa
Sequence
MTILVLGINHKTASVALREKVAFSDEKRLLALKQIKQTQLAESAVILSTCNRTEVYLHNKNVGPQNDEVWLDSCVQWFADIHQVDLEELKSCLYSQQNLQASRHLMRVASGLDSLILGEPQILGQVKQAYQMSEEYYSLHSDIGMMSTELSRLFQKTFATAKRVRTETHIGESAVSVAYAACSLARQIFDSLRNLNILLVGAGETIELVSRHLLRHGVNGLAIANRTLSRAEKLVEKLETTQKIDIFSLDRLSEGLKRADIVITSTGSPHVLISRNLIEQAQQMRHYKPMLIVDIAVPRDVEESAGEIESVYHYTVDDLHNIIQYNINQREQASQQAEHIIQQESADFFEWLKVHQFSNLIRNYRESAEIIRQDLLEKALQALQNGENTEQVLQELSHKLTKKLIHQPTQAMQTMVKAGNTEGLQAFSHAVKF

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.12 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSVPEDGLEGAIAQLCSYPHIEEVAILSTCNRLEIYIVTSETESGIREVTQFLSEWSHLPLRELRQHLFILLHQDAVMHLMRVAAGLDSLVIGEGQILSQVKNTHKLGQQYNGIGTILNRLFKQAITAGKRVRTETSIGTGAVSISSAAVELAQLKTPCLADCRVAVLGAGKMSRLVVQHLLAKGANQIAILNRSTERARELANQFSEASLQIHSLAELFNVITRYDLIFTGTSATEPLLDRSKLEPVLEVNQSLMIIDIAVPRNVHANVNELEQVQVFNVDDLKAVVAQNQESRRAMAMEAEALLEEELTAFDVWWRSLETVPTISSLRDKIETIREQELEKALSRLGSEFAEKHQEVIEALTRGIVNKILHDPMVQLRAQQDRETRRRAMQSLQMLFNLPVNDSVVNVNS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanophora paradoxa
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.542 kDa
Sequence
MNIIVVGLSHKTAPVDFREKLSIPKVRIGEAIRELCNYPHIEEVAILSTCNRLEIYLLTSDTYQGIREATQFLADSSDLSLPELRQHLFILLHQDAVMHLMRVTAGLDSLIIGEGQILSQVKQCYQLGQQYQGIGPVLNNIFKQAISAGKRVRTETQISTGAVSISSAAVELAQIKKQDLRTANITILGAGKMSRLLVQHLLSKRVKDINIVNRSVERAKLLVDQFKEANINIYNLSELKTILQNSDIVFTGTSSQEPIITPELINDCDNLPSELMLFDIAVPRNVDPNVSQFDNIKVFNVDDLKVVVSQNQQTRRKMAKAAEILLEEELSAFNIWWGSLEAIPTINKLREKAEIIRVKELEKAISRLGNEFVSDHQEIVESLTRGIVNKILHDPMVQLRAQQDIEIRGRALKILQTLFNLDTIKNGMSPTL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.217 kDa
Sequence
MTLWVLGLNHQTAPVDLRERAAFAGDALPRALESLRALPQVSEAALLSTCNRTELYAMADEAHSLVNWLETHAPGLSGHLYQHREAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTFSVAKRARTDTRVGANPVSVASTAVRLAQDSFARLNESTVLLIGAGETIELAAKHLSEGRVRRLLIANRTLAHAQTLASQHGGFALPLTDLERHLAEADVVFSATAAREPLVTRAQVEQALRTRKRKPMLLFDLAVPRDIEASVGELGDAYLYTVDDLERAVEDNRRGRREAADQAEAIIDLQVARYVETLQATARQAPLKRLRAFGDSTRDELLAKARQQLHNGKPADEVLEQLAHALTNRLLHPPTAALRNAALNNDLELTTAADRLFPEKPGYQHPPIATPIVRTDDADPAP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.12 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSVPEDGLEGAIAQLCSYPHIEEVAILSTCNRLEIYIVTSETESGIREVTQFLSEWSHLPLRELRQHLFILLHQDAVMHLMRVAAGLDSLVIGEGQILSQVKNTHKLGQQYNGIGTILNRLFKQAITAGKRVRTETSIGTGAVSISSAAVELAQLKTPCLADCRVAVLGAGKMSRLVVQHLLAKGANQIAILNRSTERARELANQFSEASLQIHSLAELFNVITRYDLIFTGTSATEPLLDRSKLEPVLEVNQSLMIIDIAVPRNVHANVNELEQVQVFNVDDLKAVVAQNQESRRAMAMEAEALLEEELTAFDVWWRSLETVPTISSLRDKIETIREQELEKALSRLGSEFAEKHQEVIEALTRGIVNKILHDPMVQLRAQQDRETRRRAMQSLQMLFNLPVNDSVVNVNS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanophora paradoxa
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.542 kDa
Sequence
MNIIVVGLSHKTAPVDFREKLSIPKVRIGEAIRELCNYPHIEEVAILSTCNRLEIYLLTSDTYQGIREATQFLADSSDLSLPELRQHLFILLHQDAVMHLMRVTAGLDSLIIGEGQILSQVKQCYQLGQQYQGIGPVLNNIFKQAISAGKRVRTETQISTGAVSISSAAVELAQIKKQDLRTANITILGAGKMSRLLVQHLLSKRVKDINIVNRSVERAKLLVDQFKEANINIYNLSELKTILQNSDIVFTGTSSQEPIITPELINDCDNLPSELMLFDIAVPRNVDPNVSQFDNIKVFNVDDLKVVVSQNQQTRRKMAKAAEILLEEELSAFNIWWGSLEAIPTINKLREKAEIIRVKELEKAISRLGNEFVSDHQEIVESLTRGIVNKILHDPMVQLRAQQDIEIRGRALKILQTLFNLDTIKNGMSPTL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Xanthomonas campestris pv. vesicatoria (strain 85-10)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.217 kDa
Sequence
MTLWVLGLNHQTAPVDLRERAAFAGDALPRALESLRALPQVSEAALLSTCNRTELYAMADEAHSLVNWLETHAPGLSGHLYQHREAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTFSVAKRARTDTRVGANPVSVASTAVRLAQDSFARLNESTVLLIGAGETIELAAKHLSEGRVRRLLIANRTLAHAQTLASQHGGFALPLTDLERHLAEADVVFSATAAREPLVTRAQVEQALRTRKRKPMLLFDLAVPRDIEASVGELGDAYLYTVDDLERAVEDNRRGRREAADQAEAIIDLQVARYVETLQATARQAPLKRLRAFGDSTRDELLAKARQQLHNGKPADEVLEQLAHALTNRLLHPPTAALRNAALNNDLELTTAADRLFPEKPGYQHPPIATPIVRTDDADPAP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.718 kDa
Sequence
MYYCISFTHKNTDIALREKLSFSNEAKKSEFLKIISTHENIEECLVISTCNRVEIVAFVKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAFKCAAKVRNETQISKNPISVASVAVAKAKELADLAQKKAVVIGAGEMGELAAKHLIAAGAKVIILNRDLQKAKDLCERLGVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLIEELPYKRYFFDIAVPRDIDINENENISVFAVDDLENVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAIRLQAKEYADKQLEIALKKGYLKKSDKEEARKLIHQVFKAFLHTPTVNLKHLQGKMQSDTVINAMRYVFDLQNNLEGLNQYKCEFDMENNDEIY

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.851 kDa
Sequence
MYYCISFTYKNTDIALREKLSFSNETKKSEFLKIISTHENIEECLVISTCNRVEIVAFVKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNSFCGVHLSRAVHSAFKCATKVRNETQISKKPISVASVAVAKAKELADLTQKKAVVIGAGEMGELAAKHLIAAGAKVIILNRDLQKAKDLCERLGVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLIEELPYKRYFFDIAVPRDIDINENENISVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAIRLQAKEYADKQLEIALKKGYLKKSDKEEARKLIHQVFKAFLHMPTVNLKHLQGKMQSDTVINAMRYVFDLKNNLEGLNQYKCEFDMENNDEIY

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.697 kDa
Sequence
MYYCISFTHKNTDIALREKLSFSNEAKKGEFLKIISTHENIEECLVISTCNRVEIVAFVKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAFKCAAKVRNETQISKNSISVASVAVAKAKELADLTQKKAVVIGAGEMGELAAKHLIAAGAKVIILNRDLQKAKDLCERLGVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLIEELSYKRYFFDIAVPRDIDINENENISVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAIRLQAKEYADKQLEIALKKGYLKKSDKEEARKLIHQVFKAFLHTPTVNLKHLQGKMQSDTVINAMRYVFDLQNNLEGLNQYKCEFDMENNDEIY

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.713 kDa
Sequence
MYYCISFTHKNTDIALREKLSFSNEAKKSEFLKIISTHENIEECLVISTCNRVEIVAFVKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAFKCAAKVRNETQISKNSISVASVAVAKAKELADLTQKKAVVIGAGEMGELAAKHLIAAGAKVIILNRDLQKAKDLCERLGVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLVEELSYKRYFFDIAVPRDIDINENENISVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAIRLQAKEYADKQLEIALKKGYLKKSDKEEARKLIHQVFKAFLHTPTVNLKHLQGKMQSDTVINAMRYVFDLQNNLEGLNQYKCEFDMENNDEIY

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter jejuni (strain RM1221)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.755 kDa
Sequence
MYYCISFTHKNTDIALREKLSFSNEAKKSEFLKIISTHENIEECLVISTCNRVEIVAFVKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAFKCAAKVRNETQISKNSISVASVAVAKAKELADLTQKKAVVIGAGEMGELVAKHLIAAGAKVIILNRDLQKAKDLCERLGVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLIEELSYKRYFFDIAVPRDIDINENENISVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAIRLQAKEYADKQLEIALKKGYLKKSDKEEARKLIHQVFKAFLHTPTVNLKHLQGKMQSDTVINAMRYVFDLQNNLEGLNQYKCEFDMENNDEIY

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.684 kDa
Sequence
MHYLNISFSHKNSTLDVREKLSYKDDYATKGCLSKLNSGESINESILISTCNRMEVFCSCSDIASATKHIFEMLAARSGVSIDELEGRADIFDDSSAIHHLFSVASSLDSMVIGETQIAGQLKDAFRFSYDNGFCSQKLARAMHHAFKCAAKVRNATDISSKPVSIASVAVSKLKSVLDNVEGKKALVIGVGEMSEITAKHLLSSGADVYITNRTKHKAEKLASECGAKVLDMQDLHKAVNEFEILFTATSSSEPIITDEIIKPCDFDRYWFDMAVPRDINYHKGDRINLYVVDDLKNIVDQNMSFREDGARKAHGIIGRSTVEFFEWLNTLNIEPMIKEIYEKAFEAARIESQRVIKKGFIPKEYEDQIHKMSQQVLKRFLHQMSSKMRSVSEESKADMLTSAVQFLIEKDQRDIPDKYKCEHALNIIEGR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia cenocepacia (strain AU 1054)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.457 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSEYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGTQSVSMAAAAVRLAQRIFEKVSDQRVLLIGAGEMIELCATHFAAQGPRELVVANRTAERGQRLAERFNGRAMPLADLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia cenocepacia (strain MC0-3)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.491 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSEYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGTQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGQRLAERFNGRAMPLADLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia cenocepacia (strain HI2424)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.491 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSEYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGTQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGQRLAERFNGRAMPLADLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.505 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGALRWLSEYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGTQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGQRLAERFNGRAMPLADLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.507 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPHAPNAPEAAILSTCNRTELYCATDDRAAREGAIRWLSEYHRISVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFETVSDQRVLFIGAGEMIELCATHFAAQSPRELVIANRTAERGQRLAERFNGRAMPLSDLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAETIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.477 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAPNTPEAAILSTCNRTELYCATDDRAAREGAVRWLSEYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGTQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGQRLAERFNGRAMPLADLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVDKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia multivorans (strain ATCC 17616 / 249)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.498 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAPNAPEAAILSTCNRTELYCATDDRAARDAAIRWLSDYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTASEAGALGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEKVSDQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGQRLAERFNGRAMPLSDLPARMQEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVSKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRLEVEKAQKMLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIELMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia mallei (strain ATCC 23344)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.299 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia pseudomallei (strain 1710b)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.299 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATNDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLADLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAEVERARKMLARGDDPDAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.267 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALSTFKSVFLGHPAPNAPEAAILSTCNRTELYCATDDRAARDAAIRWMSDYHRIPADELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKNAVRTASEAGSLGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFEQVAQQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGAKLAERFGGRAMPLSDLPARMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDARSIVPVIRHMHTQADALRRAELERARKMLARGDDPAAVLDALSQALTNKLIHGPTSALNRANGADRDSLIDLMRGFYQHAPRSSDTSDH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia vietnamiensis (strain G4 / LMG 22486)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.429 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPQAPNTPEAAILSTCNRTELYCATHDRAARDGAIRWLSEYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGTQSVSMAAAAVRLAQRIFEKVADQRVLFIGAGEMIELCATHFAAQGPRELVVANRTAERGQRLAERFGGRAMPLSDLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAEAIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVSGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Arcobacter butzleri (strain RM4018)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.438 kDa
Sequence
MSYLVISFSHKNTDIKLREKLAFNSDEDKDRFLKLILENDITKEAILLSTCNRVEIITRSLNIKQSSKDIIEKLATYSKVDFDVLYDRADIYDADGAVHHLFSVASALDSLVIGETQIVGQLKDAFRFSQAKGYCSLNITRVMHYAFKCAAQVRTATSLGTGSVSVASTAVSKAKDIIGNTKDVKALVVGAGEMSELTVKHLIASGFDVTIISRDTKKAQNLASTFEVHVNVEPYDKLTQLLITTPIMITATSAPYPIITKENAPSSNINRYWFDIAVPRDIDENISMSNLEIFSVDDLQDIVNENMSLRAEQAKTAYGIVSRMSLEFFEWLKSLEIEPIVKNLYLKGNEIIDKKVKNAIKKGFIDSKDEENIRKLCLTVITEYLHNPAKQLKDISKNMECDLVVGTVQNMFSLNENSTSKNRYKCDHLSKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Leifsonia xyli subsp. xyli (strain CTCB07)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.469 kDa
Sequence
MLICFSSSHRTAAFDLLDQLERHAPAVATALAEHSELVTGSVVLATCNRFEAYLDIDEPLPAARAVSAETVIAAVGNAAGIDADLLRSSSRVYCDDAAAEHLLSVSSGLDSVVVGEGEIAGQVRRALTTARQAGTVSQDLERLFQVASRTSRGVKNRTGIATAGRSIVRLALDLAESRVSDWSRMRVLLIGTGKYAGASLAALRDRGVADVQVHSPSGRAEKFALSHGVTAVPAGGLGAALAHAHLIVTCTTVRDYTLTPGNFGQAQQQDGIERRLVIDLGLPRNVDSAVAELPGVELLDLETISLHAPVAELNAADDAREIVGAAAAEFAAQTAEQAVKPALIALRKHVFDILDAEIARARTRGDSSEQTEAALRHLAGVLLHTPSVRARELARAGDAQRFADAAETLFGLRIEEAPVHPRLIAVDRVTAS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Burkholderia ambifaria (strain MC40-6)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.517 kDa
Sequence
MQLLTIGINHHTAPVALRERVAFPLEQIKPALVTFKNVFLGPHAPNAPEAAILSTCNRTELYCATDDRAAREGAIRWLSEYHRIPVDELAPHVYALPQSEAVRHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGTTEIGAQSVSMAAAAVRLAQRIFETVSDQRVLFIGAGEMIELCATHFAAQSPRELVIANRTAERGQRLAERFNGRAMPLSDLPTRMHEFDIIVSCTASTLPIIGLGAVERAVKARRHRPIFMVDLAVPRDIEPEVGKLKDVFLYTVDDLGAIVREGNASRQAAVAQAETIIETRVQNFMQWLDTRSVVPVIRHMHTQADALRRAEVEKAQKLLARGDDPAAVLEALSQALTNKLIHGPTSALNRVNGADRDSLIDLMRGFYQHAPRSNDQSGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain WH8102)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.454 kDa
Sequence
MHIAVVGLSHRTAPVEIRERLSIPEQTMETSLQSLRGHEQVLEASILSTCNRLEIYTLVRHPDLGVSAVSEFLSGHSGLATGELTPHLFNYHHEDAVDHLMRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAVSTGKRVRSETNLGTGAVSISSAAVELAQLKLGQSRGLDQLVTLESEQIAVVGAGRMSRLLLQHLQAKGASGVVLLNRTVQRAELLAADFPDLPVQCRPLTDLDQCLSTCSLVFTSTAADDPIIDAARLEPLNRRSKLRLIDIGVPRNIAADAAAVDGVESHDVDDLQEVVARNQEARQAMAREAEQLLQQEAQQFLEWWDSLEAVPTINRLRSSMETIRVEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTSLRAPQGRQERQQALRTVERLFSLGDD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain CC9902)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.475 kDa
Sequence
MHIAVVGLSHRTAPVEIRERLSIPEQSMEMSLKTLRGNDQVLEASILSTCNRLEIYTLVRHPELGVGAVNEFLSNHSGLQTGELSPHLFNFHHQDAVDHLLRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAVTTGKKVRSETNLGTGAVSISSAAVELAQLKLGQSRGVDDLVSLESEQIAVVGAGRMSRLLLQHLQAKGASGVVLVNRTVETAERLANDFPDLSVECRPLTDLNTFLSTSSLVFTSTAAEDPIIDASRLKPLNRRSQLRLIDIGVPRNVAADAATVDGVESHDVDDLEEVVARNQEARQAIAREAEHLLQDEAQQFLDWWDSLEAVPTINQLRSSMETIRTEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTKLRASQARSERQQALRAVERLFDLDPS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain CC9605)
Length
432 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.674 kDa
Sequence
MHISVVGLSHRTAPVEIRERLSIPEQTMETSLQSLRGNEQVLEASILSTCNRLEIYTLVRNPDLGVSAVSDFLSSHSGLETGELTPHLFSYHHEDAVDHLMRVAAGLDSLVLGEGQILSQVKKMMRLGQEHKSLGPILNRLLTQAVTTGKRVRSETNLGTGAVSISSAAVELAQLKLGQSRGLDHLVTLESEQIAVVGAGRMSRLLLQHLQAKGASGVVLLNRTVERAEQLSADFPDLPVQCRPLTDLDQYLSTCSLMFTSTAADDPIIDAARLAPLNRRSKLRLIDIGVPRNIAADAADVNGVESHDVDDLQEVVARNQEARQAMAREAEQLLQQEAQQFLEWWDSLEAVPTINQLRSSMESIRTEELQKALSRMGPDFSARERKVVEALSKGIINKILHTPVTQLRAPQTRQDRQQALRIVERLFDLEAS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Trichodesmium erythraeum (strain IMS101)
Length
431 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.969 kDa
Sequence
MNIAVIGLSHKTAPVEVREKLSLPETEIQNAISELCSGTYTQEVGILSTCNRLEIYVVTNEMQPGIREVTQFLSESSKIPLNQLRPHLFMLLHEDSIMHLMRVASGLDSLVLGEGQILAQVKQTHKLGQKYKGIGRILNRLFKQAVTAGKRVRTETSIGTGAVSVSSAAVELAQMKLEDLSNYQVAIVGAGKMSKLLVQHLLAKGANKISIINRSVGRAQDLANSFKDANIKVYSMLEMVQVIGESDLVFTSTAATELILDKAKLETILDPLKPLMLVDISVPRNIGNDVSELPNVRCFNVDDLKAVVAQNRESRRQMAMEAEVLLEEEVEAFDVWWKSLETVPTINSLRQKIETIREQELEKALSRLGSEFAEKHQEVIEALTRGIVNKILHDPMVQLRAQQDIEARRHAMETLQLLFNLESEMSSGKVI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Trichodesmium erythraeum (strain IMS101)
Length
431 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.969 kDa
Sequence
MNIAVIGLSHKTAPVEVREKLSLPETEIQNAISELCSGTYTQEVGILSTCNRLEIYVVTNEMQPGIREVTQFLSESSKIPLNQLRPHLFMLLHEDSIMHLMRVASGLDSLVLGEGQILAQVKQTHKLGQKYKGIGRILNRLFKQAVTAGKRVRTETSIGTGAVSVSSAAVELAQMKLEDLSNYQVAIVGAGKMSKLLVQHLLAKGANKISIINRSVGRAQDLANSFKDANIKVYSMLEMVQVIGESDLVFTSTAATELILDKAKLETILDPLKPLMLVDISVPRNIGNDVSELPNVRCFNVDDLKAVVAQNRESRRQMAMEAEVLLEEEVEAFDVWWKSLETVPTINSLRQKIETIREQELEKALSRLGSEFAEKHQEVIEALTRGIVNKILHDPMVQLRAQQDIEARRHAMETLQLLFNLESEMSSGKVI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Length
431 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.596 kDa
Sequence
MDGYVMVGVNHQTTPMALRDRLVLDDPALAALLVRLRARGVTEALALSTCDRVEIFGHGGDPRALRALLLAELCAVGPIEPAALAGQMVDLRGLAVVAHMFRITSALESQVLGEPHILGQVKAAHRIARDAGTVGSATEALMQAAYAIAKRVRSETRISEGPVSLAAVAAQIARDLHGDLGETCLLLLGTQEMGELIAEQLQMAGVGRLVVCAPRRPRAEAVAARLGASVGDHGALLDLLPNADIVVVGVGGGLLALGEEAMRRTLKRRRNRPVFIVDAGVPGNVEPSVQRLEAAFLYDLADLEAVAEEGRAARDQASREAHALVADAVAAFERHRAERAAVPAIAALRAHFEGERLRALAEAPDDAEKATRLLVGRLLHGPSEALRDLAAGSADKEFMTVRAEMLLRRLFDLPTSIAETGATDREDGSKG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain JA-3-3Ab)
Length
431 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.02 kDa
Sequence
MFIAVVGLSHRTAPVEIRERLSIPEAEVGERIQQLRAHPHIEEAAILSTCNRLEVYIVTPEMESGVRQTMQFLAEAKGIPLPQLRPHLFTLLYQDAVTHLMRVAAGLDSLVLGEGQILSQVKKAQQLGQACNGMDRILNRLFKAAITAGKRIRTETGIGTGAMSISSAAVELALQEQGSLSQGKVTVVGAGKMARLLVQHLLAKGAVDITVVNRSLERAEALAKQFEQPIQVLPWESLLSSIAESNLVFTSTGATQPILTYEQLAGVLQPDQPLLLVDISVPRNIDPGVEKLRGVQVFNVDHLSRIVEENRAQRQKLALAAEALVEEEVEQFMEWWRSLETVPTISSLRHKVESIREQEMEKALSRLGKDFAEKHLEVIEALTRGIVNKILHDPMVQLRAQRDIEARRRAMQILQELFNLDPMPFQAQQER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain JA-2-3B'a(2-13))
Length
431 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.026 kDa
Sequence
MFIAVVGLSHRTAPVEIRERLSIAEAEVGETIQQLRTHPHIEEAAILSTCNRLEVYIVTSEMESGVRQTMQFLAELKGIPLPQLRPHLFTLLYQDAVTHLMRVAAGLDSLVLGEGQILSQVKKAQQLGQACNGMDRILNRLFKAAITAGKRVRTETEIGTGAMSISSAAVELALQEQGSLSQGKVTVVGAGRMARLLVQHLLAKGAVDITVVNRSLERAEALAKQFEQPIQVLPWESLLNSVAESNLVFTSTGATQPILNYQQLAGVLQPDQPLLLVDISVPRNIDPDVEKLKGVQVFNVDHLSRIVEENRAQRQKLALAAEALVEEEVDQFMEWWRSLETVPTISSLRHKVESIREQEMEKALSRLGKDFAEKHLEVIDALTRGIVNKILHDPMVQLRAKRDIEARRAAMRILQELFNLDPVVFQAQQER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain ATCC 51142)
Length
430 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.929 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSIQEAKIEEALTHLKGYPHIEEVAVISTCNRLEIYAVVTDTEKGVVEITQFLSEIGHIPLSYLRRYLFTLLHQDAVRHLLRVAAGLESLVLGEGQILAQVKTTHKLSQKYKGIGRLLDRLFKQAITAGKRVRSETNIGTGAVSISSAAVELAITKVDDLATRNISIIGAGKMACLLVKHLVAKGATSITIVNRSQRRAEELAKKFPQAELTLVSLDEMMSVVGKSHLVFTSTGATEPILHQDNLREVVSAEQGLMLFDISVPRNVATNVQDLEIVEAYNVDDLKAVVAQNHASRRQMALEAEGLLEEEVEAFELWWRSLETVPTISCLRTKVESIREQELEKALSRLGTEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARQRCLQSLQMLFDLEIEIEKQFS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain ATCC 51142)
Length
430 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.929 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSIQEAKIEEALTHLKGYPHIEEVAVISTCNRLEIYAVVTDTEKGVVEITQFLSEIGHIPLSYLRRYLFTLLHQDAVRHLLRVAAGLESLVLGEGQILAQVKTTHKLSQKYKGIGRLLDRLFKQAITAGKRVRSETNIGTGAVSISSAAVELAITKVDDLATRNISIIGAGKMACLLVKHLVAKGATSITIVNRSQRRAEELAKKFPQAELTLVSLDEMMSVVGKSHLVFTSTGATEPILHQDNLREVVSAEQGLMLFDISVPRNVATNVQDLEIVEAYNVDDLKAVVAQNHASRRQMALEAEGLLEEEVEAFELWWRSLETVPTISCLRTKVESIREQELEKALSRLGTEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARQRCLQSLQMLFDLEIEIEKQFS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Lawsonia intracellularis (strain PHE/MN1-00)
Length
430 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.524 kDa
Sequence
MEQHIYLIGMNHRTASIDVRECFALTEHCSKDDWAIPLIKGIQESLILSTCNRVEILAVGDSNTPEIILSAWAKVKTRSIEELVPHTYTYQGRSAISHLFCVASSLDSMVLGEPQILGQLKDAYKLATIAGASKTILNRLLHKAFSVAKRVRTETSIASNAVSISYAAVKLAKKIFGTMNQYKAMLIGAGEMAELAAMHLMQAGIQQLKIVNRTYSQAQELASQFRGEAIPFEKLVTYLAEVDIVISSTGAPQTIIHFNDIKNILSKRKHYPMLFIDIAVPRDIDPNVHQLDNIYLYDIDDLKEIVEDNIVQRQDEAIKAKHIIQDEIDSFCAWLQALILQPTIVDLRKRFSTYAEEELERTLKKIGPVDRKTREALETMIDALIRKLTHDPISYLKCAHRTIDTNHITLARQMFNLDKIPQTNKAVNED

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Length
430 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.136 kDa
Sequence
MQIAVIGLSHRTAPVEIRERVSIAEGQVPEYVSRLRSCSQVAECAILSTCNRLEIYTVLRDSEHGLREVTRFLAESKGVLLPTLQRHLFVLLHQDAVMHLMRVAAGLDSIVLGEGQILAQVKMTQSLAQQGKGVDRVLNQLFKTAITAGKRVRSDTNIGTGAVSVSSAAVEMALRKKGPLHNQRCLVVGAGKMGELLVRHLLAKGARQIIVLNRSLEKAAQMVEQFGLMLPVATVDELTNYVPCSDLIFTCTGATEPLLTLEKMSSLRRDQSLMIFDIAVPRNVATEVDELPNVQLFNVDHLKQVVEENRAYRQLMVTQCEEILLEQLDEFLDWWRGLEAVPTINQLRQKVETIREQELEKALSRLGTEFAEKHQGIIDSLTRAIVNKILHDPMVQLRAQRDIEARRRALQTLQTLFNLEAQSNPEPPTL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas fluorescens (strain SBW25)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.669 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVEALQQLCRLTDSREAAILSTCNRSELYIEQEHLSADVVLRWLADYHHLDLDDLRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFNSAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQRSQALLIGAGETITLVARHLHDLGVKRIVVANRTLERASILAEQFGAHAVLLADIPAELVRSDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAAQAAEEMVSAGADDFMVRLRELAAVDVLKAYRQQGERLRDEELLKAQRLLANGSSAEDVLVQLARGLTNKLLHAPSVQLKKLTAEGRLDALAMAQELFALGEGASDSSSDKKLQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Polaromonas naphthalenivorans (strain CJ2)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.754 kDa
Sequence
MSVWALGLNHHTAPLDLRGRFAFAIDQIEPTLRGLRASLARQPEATLLSTCNRTEIYCAGDTNDLDSTMEWLAHNGGVSPSLLRAHAYTLQDDQAARHAFRVASGLDSMVLGEPQILGQMKDAVRAAEDAGAMGTTLHQLFQRSFAVAKEVRTSTEIGAHSISMAAAAVRLAGQLFEDLGDIKVLFVGAGEMIDLAATHFAAKNPKAMAIANRSLDRGEKLASRFGAEVMRLGDLPGRLHEFDAVISCTASTLPIIGLGAVERALKRRKHRPMFMVDLAVPRDIEPEVKELSDIYLYTVDDLAHVVQTGRDSRQAAVAEAEVIIDAGVQNFMHWLDQRGSVPLIQQLNAQADAWRAAEIVRAKKLLARGESIEEVLEAMSRGLTQKMLHGAMAELHAGDASSREATARTVSKLFLRGQMPRAATERKER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.82 kDa
Sequence
MSLIVIGLNHKTAPVEIREKIAFNSKEAIKEALKELIQREGIGEVVIISTCNRVEIYVYTANVSDLKRENQVEETIKAFLSNFHNIEIGEFENYLYVYKDTEAVEHLFKVASSLDSMIVGEPQITGQVKESYEIALSERTTSLILNYLMNRALFTAKRVRNETRIGENPVSVSYAAVGLIKKVFDELSKKSILLVGAGEMAELALRHLIGSGIKNVYLTNRTFQRAEEIAKEFNGVAVPFGNLKEQLVKTDIVICSTGAPHYVITEQMLKEVMPLRKHKPIFFIDISVPRNVDPACNELDNVYLYNIDDLQDVVDSNILERKKEAEKALSIVQEETEKFFQWLNSLESVPVIVSIRNKAEQVRQEEIEKFKAKYKDLPPELINSIDYLTQSIINKIMHSPTVALKNNCENKEILIFSARRLFGLDSEEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Verminephrobacter eiseniae (strain EF01-2)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.982 kDa
Sequence
MAVWALGINHSTAPLDLRGRFAFALDQIAPRLQGLRQSLSSHPGVETAMLSTCNRTEIYCAAEQAAIDHTLGWLAHSGGVSTALLRAHSYTLQDSRAARHAFRVASGLDSMVLGEAQILGQMKDAVRAAETAGVLGSTLNQLFQRSFAVAKEVRSSTEIGAHSISMAAAAVRLAGQLFEDLSQIRVLFVGAGAMIALCATHFAAKNPLGLALANRTLERGEQLAARFGATVLRLADLPERLHEFDAVISCTASSLPIIGLGAVERALKKRRHRPMFMVDLAVPRDIEPEVKALGDVYLYTVDDLASVVQTGQASRQAAVAQAEAIIDAGVQSFMHWLAQRNPVGGVVPLIRQLNAQTEVWRASEIARAKKLLAKGEAPDAVLDALARGLTQKMLHGTMAELRAGDADMRAQTAQTVARLFLRAQSNHDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Polaromonas naphthalenivorans (strain CJ2)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.754 kDa
Sequence
MSVWALGLNHHTAPLDLRGRFAFAIDQIEPTLRGLRASLARQPEATLLSTCNRTEIYCAGDTNDLDSTMEWLAHNGGVSPSLLRAHAYTLQDDQAARHAFRVASGLDSMVLGEPQILGQMKDAVRAAEDAGAMGTTLHQLFQRSFAVAKEVRTSTEIGAHSISMAAAAVRLAGQLFEDLGDIKVLFVGAGEMIDLAATHFAAKNPKAMAIANRSLDRGEKLASRFGAEVMRLGDLPGRLHEFDAVISCTASTLPIIGLGAVERALKRRKHRPMFMVDLAVPRDIEPEVKELSDIYLYTVDDLAHVVQTGRDSRQAAVAEAEVIIDAGVQNFMHWLDQRGSVPLIQQLNAQADAWRAAEIVRAKKLLARGESIEEVLEAMSRGLTQKMLHGAMAELHAGDASSREATARTVSKLFLRGQMPRAATERKER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.82 kDa
Sequence
MSLIVIGLNHKTAPVEIREKIAFNSKEAIKEALKELIQREGIGEVVIISTCNRVEIYVYTANVSDLKRENQVEETIKAFLSNFHNIEIGEFENYLYVYKDTEAVEHLFKVASSLDSMIVGEPQITGQVKESYEIALSERTTSLILNYLMNRALFTAKRVRNETRIGENPVSVSYAAVGLIKKVFDELSKKSILLVGAGEMAELALRHLIGSGIKNVYLTNRTFQRAEEIAKEFNGVAVPFGNLKEQLVKTDIVICSTGAPHYVITEQMLKEVMPLRKHKPIFFIDISVPRNVDPACNELDNVYLYNIDDLQDVVDSNILERKKEAEKALSIVQEETEKFFQWLNSLESVPVIVSIRNKAEQVRQEEIEKFKAKYKDLPPELINSIDYLTQSIINKIMHSPTVALKNNCENKEILIFSARRLFGLDSEEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Verminephrobacter eiseniae (strain EF01-2)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.982 kDa
Sequence
MAVWALGINHSTAPLDLRGRFAFALDQIAPRLQGLRQSLSSHPGVETAMLSTCNRTEIYCAAEQAAIDHTLGWLAHSGGVSTALLRAHSYTLQDSRAARHAFRVASGLDSMVLGEAQILGQMKDAVRAAETAGVLGSTLNQLFQRSFAVAKEVRSSTEIGAHSISMAAAAVRLAGQLFEDLSQIRVLFVGAGAMIALCATHFAAKNPLGLALANRTLERGEQLAARFGATVLRLADLPERLHEFDAVISCTASSLPIIGLGAVERALKKRRHRPMFMVDLAVPRDIEPEVKALGDVYLYTVDDLASVVQTGQASRQAAVAQAEAIIDAGVQSFMHWLAQRNPVGGVVPLIRQLNAQTEVWRASEIARAKKLLAKGEAPDAVLDALARGLTQKMLHGTMAELRAGDADMRAQTAQTVARLFLRAQSNHDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.896 kDa
Sequence
MNYMSVSFTHKNTDIIVREKLSFANDVKKREILKLICSNKAIKECLVLSTCNRVEVLAYIDDFNYTSDYVIKAISKLSGVDFDELKERADIYEDDGAIHHLFSVASSLDSLVVGETQIVGQLKDAYNFAKNERKSGVMLDLAINSALKCAAVIRSKTDISKNPISVASVAVCMAREKIGDLGGTTAVVVGAGEMAELACKHLITHKAKVIIINRNIDHAKKLAESLGENASIAEFSNLGEFINKYALIFSATGANKPIITDLLAKPQNFKRYFFDIAVPRDIDITCDDLSEVYAVDDLEEIVRKNLLLREEQAQIAYSIVGRETTKFYKDLKTLSSTPIIKALRNSAKKVAETELKKAIKRGYLRHSDIDEARKLIHQVFKAFLHTPTVNLKNLDENAQNDINAIAEIFGIEEDFDKFCENSLENKNEI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Herminiimonas arsenicoxydans
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.289 kDa
Sequence
MQLLAVGLNHTTAPVSLREKVAFPADQLGQAVASARVWYGRSDSKTYSDEAAILSTCNRTELYAASHQPGGVNEAIDLTAHFLADYHKLPYSELRPYLYALPQDNAVRHAFRVASGLDSMVLGEPQILGQMKDAVRQAEAAGGLGTYLHQMFQRTFAVAKEVRSNTEIGAHSVSMAAASVRLSQRIFDTISEQNVLFIGAGEMIELCATHFAAQNPKSLTIANRTLERGETLAHRFNGRAIRLADLPDQLASYDIVISSTASSLPIIGLGMVERAIKARRHKPMFMVDLAVPRDIETEIGRLDDVFLYTVDDLGTFVQTGLENRQAAVTQAEAIIETRVQSFMHWIDARAVVPVIQDLHESSEMMRMIELERARKLLAKGEDIDAVLEALSKGLTAKFLHGPQQALNNAQGDERTRLAALLPQLFRTKR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Janthinobacterium sp. (strain Marseille)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.029 kDa
Sequence
MQLLAVGLNHTTAPVSLREKVAFPADQLGQAVASARSWYGRSDATTYTDEAAILSTCNRTELYAASNLPGGVNEAIDITAHFLADYHKLPYAELRPYLYALPQDNAVRHAFRVASGLDSMVLGEPQILGQMKDAVRQAEAAGGLGTYLHQMFQRTFAVAKEVRSTTEIGAHSVSMAAASVRLSQRIFDKISEQNVLFIGAGEMIELSATHFAAQNPKSVTIANRTLERGQTLAHRFNGKAIRLADLPDQLASYDIVISSTASSLPIIGLGMVERAIKARRHKPMFMVDLAVPRDIEAEIGRLDDVFLYTVDDLGSFVQTGVENRQAAVAQAEAIIETRVRSFMHWIDARAVVPVIQDLHESSETMRMIELERARKLLAKGEDIDAVLEALSKGLTAKFLHGPQQALNNAQGDERARLAALLPQLFRTKR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.134 kDa
Sequence
MALVTLGINHRTAPVEIRERVAFTPERMAEAFSELRAASGASEAAILSTCNRTELYLAGDDDCAPSVLRWLAGFHELDVADLENVLYVHRDSDAVRHMMRVAAGLDSMVLGEPQILGQLKDAYALAREHSATGSFLSRLFEQTFSVAKRVRTQTAIGENPVSVAYASVSMAHHIFADMSRNKALLIGAGKTIELVARHLAEAGVRSFLVANRTLEKAQALAEAHGGKGILLSEIPDHLSDVDIVISSTASPLPILGKGAVERALKKRKHRPYFMVDIAVPRDIEPEVASLADVYLYTVDDLRQVIEENIRSREGAAREAENLISSGVQDFLDQLRALDAVSTLKVFRQRAELLRDVETEKALRALRNGTDPETALRSLARGLTNKLLHQPSVQVRKAMAEGRTEVTECLRELYQLDALEADEPTTTEKL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)
Length
429 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.13 kDa
Sequence
MLIAVAGMSHRSAPVEARERVAFAPCAARSFLRRLREEDGVPEAVLLSTCNRTELYVVAEAEPARDRLLGLLAEDRGVEPGSLYRDTYWHTDAEAVRHLYRVSASLDSMVVGEAQILGQVRDAYRMATEERCTGPVLNRLFHTALRVGKRVRAETGIGDSSLSVPHVAAKLAGEVFGSLEGRRALVLGAGEMSELLVRHLRDRGVAEIRIANRTRERAERLAALFGGRAADLGDLPRELARADIVVSSTGSGEWVIRGPEVAAALESREEPLFLIDIAVPRDVDPVVQSIEGAFLYDIDDLQAVVERNAEDRQEAAAAAEEMIGPAVVEFMSWLSTLHVAPLIKELRDGAERIRRHEVSRALRKMDLSPEQEEAVERMSRSIVNKLLHGPISEIKARAGAGDPLDSAEVRRRLLSLRGPGVELHPSREP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas fluorescens (strain Pf0-1)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.686 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVEALQQLCRLTDSREAAILSTCNRSELYIEQDQLSADIVLRWLADYHHLSLDELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTIGPLLGRLFQATFNAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQRSQALLIGAGETITLVARHLHELGVKRIVVANRTLERASLLAEQFGAHAVLLSDIPAELVRSDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAAQAAEEMVSVGADDFMVRLRELAAVDVLKAYRQQSERLRDEELQKALRLLANGGNAEDVLGQLARGLTNKLLHAPSVQLKKLSAEGRLDALAMAQELFALEGSPDSFSDKKPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain PCC 7424)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.869 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSIPEAKLEEVLAHLKSYPHIQEVAILSTCNRLEIYAVVTETEQGIIEISQFLSEKGHIPLHHLRRHLFILLHQDAVRHLMRVAAGLESLVLGEGQILAQVKNTHKLAQKYGGIGRLLDRLFKQAMTAGKRVRSETSIGTGAVSISSAAVELAQMKVIDICVCRVTIIGAGKMSRLLVQHLLSKGVSKIAIVNRSLRRAQELAGLFPEAQLQLHPLEEMINAVSVSDIVFTSTGATEPILNRSNLESIIAVNQSLMLVDISVPRNVDADVQQLEQIQSYNVDDLKAVVAANQESRRRLAQEAEGLLEEEVESFELWWRSLDTVPTISCLRDKVETIREQELEKALSRLGTEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARKRCLQSLQMLFDLDIEEQYT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain PCC 8801)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.813 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSIQEAKLEEALTHLRGYPHIEEVAIISTCNRLEIYAVVSDTEKGVVEITQFLSETGHLPLNYLRRYLFTLLHQDAVRHLLRVAAGLESLVLGEGQILAQVKTTHKLGQKYKGIGRLLDRLFKQAITAGKRVRSETNIGTGAVSISSAAVELAQTKAEDLANRRISIIGAGKMARLLVQHLLSKGATDITIVNRSHHRAQELAAQFPQASLNLQLLPEMMQVVASSHIVFTSTAATEPILHRENLTAALDPNHALMLFDISVPRNVASDVHGMEGIESYNVDDLKAVVAQNYESRRQMAQEAEGLLEEEVEAFDLWWRSLETVPTISCLRTKVETIREQELEKALSRLGTEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARKRCLESLKMLFDLEIEEQFG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain PCC 7424)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.869 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSIPEAKLEEVLAHLKSYPHIQEVAILSTCNRLEIYAVVTETEQGIIEISQFLSEKGHIPLHHLRRHLFILLHQDAVRHLMRVAAGLESLVLGEGQILAQVKNTHKLAQKYGGIGRLLDRLFKQAMTAGKRVRSETSIGTGAVSISSAAVELAQMKVIDICVCRVTIIGAGKMSRLLVQHLLSKGVSKIAIVNRSLRRAQELAGLFPEAQLQLHPLEEMINAVSVSDIVFTSTGATEPILNRSNLESIIAVNQSLMLVDISVPRNVDADVQQLEQIQSYNVDDLKAVVAANQESRRRLAQEAEGLLEEEVESFELWWRSLDTVPTISCLRDKVETIREQELEKALSRLGTEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARKRCLQSLQMLFDLDIEEQYT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cyanothece sp. (strain PCC 8801)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.813 kDa
Sequence
MNIAVVGLSHKTAPVEVREKLSIQEAKLEEALTHLRGYPHIEEVAIISTCNRLEIYAVVSDTEKGVVEITQFLSETGHLPLNYLRRYLFTLLHQDAVRHLLRVAAGLESLVLGEGQILAQVKTTHKLGQKYKGIGRLLDRLFKQAITAGKRVRSETNIGTGAVSISSAAVELAQTKAEDLANRRISIIGAGKMARLLVQHLLSKGATDITIVNRSHHRAQELAAQFPQASLNLQLLPEMMQVVASSHIVFTSTAATEPILHRENLTAALDPNHALMLFDISVPRNVASDVHGMEGIESYNVDDLKAVVAQNYESRRQMAQEAEGLLEEEVEAFDLWWRSLETVPTISCLRTKVETIREQELEKALSRLGTEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARKRCLESLKMLFDLEIEEQFG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter curvus (strain 525.92)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.977 kDa
Sequence
MHYLNISFTYKNTDISVREKLAFDSDEKKDQILRLLKSSKNIIECMVLSTCNRVEVLAYTNDIKSAMTHIIRCLTVYSGVFEDELFERADIYEDSGAVHHLFAVASSLDSLVVGETQIVGQLKNAFKFAFDNASSGEHISRLVHYACKCAARVRNETQISKNPISVSSVAVAKAKEIFGTLENKTAVVIGAGEMGELAAKHLITSGANVIIINRSSDHVEELVENLGDKASWDSILKLKEYINKYDLIFSSTSAPHAIITGELIEPQEFRRYFFDIAVPRDIDLVNTDKISVYSVDSLEEMVRRNLALREEQAQTAYSIVGQSTNEFLKFLKDNISIPLIKTIRKKAEICAEAELEKALKKGYLKHSDKEEAAKLIHQVFKAFLHSPTINLKSLASKNDAEQIAGGIKFLFDIKEENLENLTKDIDEI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Microcystis aeruginosa (strain NIES-843)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.653 kDa
Sequence
MNIAVVGLSHKTAPVEIREKLSIPEAKIESALTHLKGYPHIQEVAIISTCNRLEIYAVVTDTEKGVVEITQFLAEIGHIPLNVLRRYLFTLLHQDAVRHLLRVSAGLESLVLGEGQILAQVKNTHKLAQKYNTISQLLDRLFKQAMTAGKRVRTETSIGTGAVSISSAAVELAHAKVTDLSSKKIAIIGAGKMSRLLVTHLLAKGSQQIAIINRSQRRAQELAREFPHLPLQLYGLEEMMTTVAASDIVFTSTGATEPILTKTLLTEVTITANSLMLIDISVPRNVHTDVKELAQVQAFNVDDLKAVVAANQESRRQMAREAEALLEQEVEAFELWWRSLDTVPTISCLRSKIEDIREQELEKALSRLGTEFAEKHQEVIEAMTRGIVNKILHEPMVQLRAQQDIEARKRCLQSLQMLFNLSVGEEYS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Length
428 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.881 kDa
Sequence
MNIAVVGLSHKTAPVEIREKLSIPEPQTESAIAQLTSYPHIDEVAILSTCNRLEIYIVAGETDHGIREVTQFLSEHSKLPVHSLRQHLFVLLHEDAVMHIMRVAAGLDSLVLGEGQILAQVKNTHKLGQQYNGIKTILNRLFKQALTAGKRVRTETSIGTGAVSISSAAVELAQIKAENLAACRVTILGAGKMSRLLVQHLVSKGATQISIVNRSRERAQELAKQFSEHPIRTHLLPEMMTVIAESHLVFTSTSATEPILDRAKLEMVLAPNQPLMLFDISVPRNVHTDVNELANVQAFNVDDLKAVVAQNYESRRKMAQEAERLLEEEIEAFDIWWRSLETVSTISSLRSKIETIREQELEKALSRLGSEFGDKHQEVIEALTRGIVNKILHDPMVQLRAQQDVEARRRCMQTLQMLFNLDVGEQFS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Length
427 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.964 kDa
Sequence
MSFFALGVNHQTASVELREQIAFNAERLSNLLAEQRHHESLKDLVVVSTCNRTEVYAMAEDAESLLKWLADANNIDVKQLIHHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAFYAAKRVRSETAVGSHAVSMGYAVAQLALQVFSKPEKLTVMVVAAGEMNSLVAKHLAEMGVAKMIICNRSRERADQLAQEIAHQVEVEIIDFSDLAENLYRADVVSSCTGSLHQVIAYADVKTALKKRRYQQMLMVDLAVPRDIDPKVESLDGVYLYGVDDLQSVIDENLAQRRQAAVEAEVMVNQLATQLITHQKVKEAGSTIHAYRQHSEEISQRELTHALEALHHGGNPEQVLQQFAHRLTQKLIHPTSMLLREAAKAESPDYFEWLQQHLQDVFDHERKPKR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Acinetobacter baumannii (strain AYE)
Length
427 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.964 kDa
Sequence
MSFFALGVNHQTASVELREQIAFNAERLSNLLAEQRHHESLKDLVVVSTCNRTEVYAMAEDAESLLKWLADANNIDVKQLIHHVYRYENAQAITHLMRVASGLDSLMLGEPQILGQVKSALALSKEAQTVSPELNSVFEYAFYAAKRVRSETAVGSHAVSMGYAVAQLALQVFSKPEKLTVMVVAAGEMNSLVAKHLAEMGVAKMIICNRSRERADQLAQEIAHQVEVEIIDFSDLAENLYRADVVSSCTGSLHQVIAYADVKTALKKRRYQQMLMVDLAVPRDIDPKVESLDGVYLYGVDDLQSVIDENLAQRRQAAVEAEVMVNQLATQLITHQKVKEAGSTIHAYRQHSEEISQRELTHALEALHHGGNPEQVLQQFAHRLTQKLIHPTSMLLREAAKAESPDYFEWLQQHLQDVFDHERKPKR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter concisus (strain 13826)
Length
427 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.802 kDa
Sequence
MHYLDISFTYKNTDISVREKLAFDSDEKKEQILKLINSNKNIKESMVLNTCNRVEIIASVEDVKAATAHIIRCMSIFSGVFEDELYERADIYENSGAAHHLFAVASSLDSLVVGETQIVGQLKNAFKFAYDNNSCGEDISKIIHYACKCAAKVRNETQISKNPISVSSVAVAKAKEIFGTLEGKTAIVVGAGEMGELAAKHLISSGAEVIIINRSSERVEQLVDSLGDNASWDSILKLKEYVNNYDLIFSSTAAPHAIITGEIIEPREFHRYFFDIAVPRDIDLLNTELISVYTVDSLEEIVRKNLALREEQAQKAYSIVGQDTSEFLKTLKEDMSVPLIKSIRKQAEICAKNELEKAIKKGYLKHSDYDEAQKLIHQVFKAFLHQPTMKLKGLADEERASELSNGVKFLFDIKDEQNFQAGDIDEI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Stenotrophomonas maltophilia (strain R551-3)
Length
427 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.629 kDa
Sequence
MTLWVLGLNHQTAPVELRERAAFAGEALPRALGSLRDTPQIAEAVLLSTCNRTELYAVADSAQALDQWLHTQAGDLQGYLYQHADAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWSTARDHGLLGQRLDRLFQQTFSVAKRARTDTQVGANPVSVASAAVRLAQNAFARLDDSTVLLVGAGETIELAARHLSEGKVRRLLIANRTLAHAQELASRHGGVALPLTELDRHLGEADVVFSATAAREPVIHREMVAKALRTRRHKPMLLFDLAVPRDIEADVATLNDAFLYTVDDLERAVEDNRRGRREAAAEAEAIIDLQVSRFVETQQASAHQAPLRQLRAFGEATRTELLERARQQLANGKPADEVLELLAHGLTNRLLHPPTAALRAAALSGDADLTRAAERLFPATPGYRHPPVRPDDADPAP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Stenotrophomonas maltophilia (strain K279a)
Length
427 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.583 kDa
Sequence
MTLWVLGLNHQTAPVELRERAAFAGEALPRALGSLRDTPQIAEAVLLSTCNRTELYAVADSAQALDQWLHAQAGDLQGYLYQHADAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWSTARDHGLLGQRLDRLFQQTFSVAKRARTDTQVGANPVSVASAAVRLAQNAFARLDDSTVLLVGAGETIELAARHLSEGKVRRLLIANRTLAHAQELASRHGGVALPLTELDRHLGEADVVFSATAAREPVIHREMVAKALRARRHKPMLLFDLAVPRDIEAEVGTLNDAFLYTVDDLERAVEDNRRGRREAAAEAEAIIDLQVSRFIETQQASAHQAPLRQLRAFGEATRTELLERARQQLANGKPADEVLELLAHGLTNRLLHPPTAALRAAALSGDADLTRAAERLFPATPGYRHPPVRPDDADPAP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Length
427 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.694 kDa
Sequence
MAQVCSISVNHRHAGIEGIERARFRDPDVAMLRLLSLPGVSEAVVLQTCNRVEIYAVAESVEDIVGFARAEGMPLEIAEVRAGDDCLKGLLRLACGLESMIVGEDQILGQLKTALLQARRLGTIGPVLSTAIQKSIHVGARARIETEINKGSVSIGSAAVELAESLLGDLRGRTILVVGAGEMGTLVANAMAEKSLRAIYVANRTFEQAEKLASSLQGVAIRLERLCDYMGSADVVICATGAPHLIITKKMVEQCKGEKPLIFIDITNPRNIEETVGEVPGVTLHNIDSLRQINEASMRRRQGEARKVEAIIEEELVLLQRDIRRLHADRVIGDLYQRTDHIRATELRRAVARLSTAGSLTEQQISILHDFSMALTNKILAAPTRQLRRAAERCDEDCLRTAEELFDLWVEESNGIPGNKTKASKTD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechocystis sp. (strain PCC 6803 / Kazusa)
Length
427 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.526 kDa
Sequence
MNIAVVGLSHKTAPVEIREKLSIQEAKLEEALTHLRSYPHIEEVTVISTCNRLEIYAVVTDTEKGVVEITQFLSETGNIPLATLRRYLFTLLHEDAVRHLMRVAAGLESLVLGEGQILAQVRTTHKLGQKYKGVGRLLDRLFKQAITAGRRVRTETDIGTGAVSISSAAVELVHRQVDLSSQKTVIIGAGKMACLLVKHLLAKGATDITIVNRSQRRSQDLANQFPQAQLTLCPLTDMFTAIAAGDIVFTSTGATEPILNCENLTGCVINRKSLMLVDISVPRNVAADVHAMEQVRAFNVDDLKEVVAQNQASRRQMARQAEALLEEEIAAFDLWWRSLETVPTISSLRSKVEDIREQELEKALSRLGSEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARKQCLRSLKMLFDLEVEEQFG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas mendocina (strain ymp)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.628 kDa
Sequence
MAFIALGINHKTASVEVRERVAFTPEQLVEALQQLCRLTPSREAAILSTCNRSELYLEQDQLSSDEVLKWLADYHRLSLDELRACAYVHSEQDAVRHMMRVACGLDSMVLGEPQILGQLKSAYAVAREAGTVGPLLGRLFQATFSTAKTVRTDTAIGENPVSVAFAAVSLAKQIFADLHRSQALLIGAGETISLVARHLHDQGIKRIVVANRTLERASQLAEQFGAHAVLLSDIPDELAHSDIVISSTASQLPILGKGAVESALKKRKHKPIFMVDIAVPRDIEPQVGELDDVYLYTVDDLHEVIEENLKSRQGAAQAAEELVAAGTEDFMQRLRELAAVDVLKAYRQQAERLRDEELAKAQRMLVNGASAEDVLAQLARGLTNKLLHAPSVRMKKLTAEGRIDALSLAQELFALDEGAPQDKGLQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Polaromonas sp. (strain JS666 / ATCC BAA-500)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.573 kDa
Sequence
MSVWALGLNHTTAPLDLRGRFAYALDQIEPTLRGLRESLARQPEATLLSTCNRTEIYCAGDHNDLEHTLEWLAHNGGVSPALLRSHAYTLQDDQAARHAFRVASGLDSMVLGEPQILGQLKDAVRAAEDAGAMGSTLHQLFQRSFAVAKEVRTSTEIGAHSISMAAASVRLAGQLFENLGDIRVLFVGAGEMIDLAATHFAAKTPKSMAIANRTLERGEKLASRFGAEVMRLADLPSRLHEFDAVISCTASTLPIIGLGAVERAVKLRKHRPMFMVDLAVPRDIEPEVKDLPDIYLYTVDDLAHVVQTGKDNRQAAVAQAEVIIDAGVQNFMHWLGQRRTVPLIQQLNAQTDEWRAAEIARAKKLIAKGEPMDAVLDALTRGLTQKMLHGALAELHAGDAASREATAHTVSRLFLRGQPPKEHKER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.734 kDa
Sequence
MNIISVGVNHKTAPIEIRERISLSEVQAKEFLSDIISSGIAQEAMVLSTCNRTELYVVPGMSEVTGHYLKEYLISYKNAEKEVRPEHFFNRFYCNTARHLFEVSSATDSLVLGEGQILGQVKNAYRIAVEEQSAGILLTRLCHTAFSVAKKVKTRTRIMEGAVSVSYAAVELAQKIFSNLSMKKILLVGAGETGELAAKHMFQKNARNIVITNRTMSKAEALAEELGTNQVLPFETFRDNLHEFDIIITAVSTKDYVLKAPDMHQSMQKRRLKPVIILDLGLPRNVDPEIRSLQNMFLKDIDDLKHIIDKNLEMRRSELPKVQEIIDEELVGFGQWINTLKVRPTIVDLQSKFLEIKEKELERYRHKVSDEELRRMERLSDRILKKILHHPIKMLKSPVDTADNIPSKVNLVRNIFDLEEQNQLKQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Xanthomonas axonopodis pv. citri (strain 306)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.831 kDa
Sequence
MTLWVLGLNHQTAPVDLRERAAFAGDALPRALESLRALPQVSEAALLSTCNRTELYAMAEEAHSLVNWLETHAPGLSGYLYQHQEAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTFSVAKRARTDTRVGANPVSVASTAVRLAQDSFARLNESTVLLIGAGETIELAAKHLSEGRVRRLLIANRTLAHAQTLASQHGGFALPLTDLERHLAEADVVFSATAAREPLVTRVQVEQALRARKRKPMLLFDLAVPRDIEASVGELSDAYLYTVDDLERAVEDNRRGRREAADQAEAIIDLQVARYVETLQATAHQAPLKRLRAFGDSTRDELLAKARQQLHNGKPADEVLEQLAHALTNRLLHPPTAALRDAALNNDLELTAAADRLFPEKPGYQHPPHSYPDREDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Polaromonas sp. (strain JS666 / ATCC BAA-500)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.573 kDa
Sequence
MSVWALGLNHTTAPLDLRGRFAYALDQIEPTLRGLRESLARQPEATLLSTCNRTEIYCAGDHNDLEHTLEWLAHNGGVSPALLRSHAYTLQDDQAARHAFRVASGLDSMVLGEPQILGQLKDAVRAAEDAGAMGSTLHQLFQRSFAVAKEVRTSTEIGAHSISMAAASVRLAGQLFENLGDIRVLFVGAGEMIDLAATHFAAKTPKSMAIANRTLERGEKLASRFGAEVMRLADLPSRLHEFDAVISCTASTLPIIGLGAVERAVKLRKHRPMFMVDLAVPRDIEPEVKDLPDIYLYTVDDLAHVVQTGKDNRQAAVAQAEVIIDAGVQNFMHWLGQRRTVPLIQQLNAQTDEWRAAEIARAKKLIAKGEPMDAVLDALTRGLTQKMLHGALAELHAGDAASREATAHTVSRLFLRGQPPKEHKER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.734 kDa
Sequence
MNIISVGVNHKTAPIEIRERISLSEVQAKEFLSDIISSGIAQEAMVLSTCNRTELYVVPGMSEVTGHYLKEYLISYKNAEKEVRPEHFFNRFYCNTARHLFEVSSATDSLVLGEGQILGQVKNAYRIAVEEQSAGILLTRLCHTAFSVAKKVKTRTRIMEGAVSVSYAAVELAQKIFSNLSMKKILLVGAGETGELAAKHMFQKNARNIVITNRTMSKAEALAEELGTNQVLPFETFRDNLHEFDIIITAVSTKDYVLKAPDMHQSMQKRRLKPVIILDLGLPRNVDPEIRSLQNMFLKDIDDLKHIIDKNLEMRRSELPKVQEIIDEELVGFGQWINTLKVRPTIVDLQSKFLEIKEKELERYRHKVSDEELRRMERLSDRILKKILHHPIKMLKSPVDTADNIPSKVNLVRNIFDLEEQNQLKQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Xanthomonas axonopodis pv. citri (strain 306)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.831 kDa
Sequence
MTLWVLGLNHQTAPVDLRERAAFAGDALPRALESLRALPQVSEAALLSTCNRTELYAMAEEAHSLVNWLETHAPGLSGYLYQHQEAEAVRHLFRVATGLDSMVLGEPQILGQVKDAWAVARAHGALGSGLDRLFQQTFSVAKRARTDTRVGANPVSVASTAVRLAQDSFARLNESTVLLIGAGETIELAAKHLSEGRVRRLLIANRTLAHAQTLASQHGGFALPLTDLERHLAEADVVFSATAAREPLVTRVQVEQALRARKRKPMLLFDLAVPRDIEASVGELSDAYLYTVDDLERAVEDNRRGRREAADQAEAIIDLQVARYVETLQATAHQAPLKRLRAFGDSTRDELLAKARQQLHNGKPADEVLEQLAHALTNRLLHPPTAALRDAALNNDLELTAAADRLFPEKPGYQHPPHSYPDREDR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobium chlorochromatii (strain CaD3)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.479 kDa
Sequence
MNIISVGVNHKTAPIEIRERISLSEVQNKEFITGLVSSGLAHEAMVLSTCNRTELYVVPAMHEVTGEFLKEYLISYRDARKEVRPEHFFSRFYCSTARHLFEVASAIDSLVLGEGQILGQVKNAYRIAAEAQCAGIMITRLCHTAFSVAKKVKTKTRIMEGAVSVSYAAVELAQKIFSNLSLKKVLLVGAGETGELAAKHMFAKNARNIVITNRTISKAEALAEELGTNQVLPYESYKEHLHEFDIIITAVSTKDYALTEADMQPAMARRKLKPVIILDLGLPRNVDPNISKLQNMFLKDIDDLKHIIDKNLEKRRRELPKVHAIIEEELIAFGQWINTLKVRPTIVDLQSKFIEIKEKELERYRYKVSEEELQRMEHLTDRILKKILHHPIKMLKAPIDTTDSIPSRVNLVRNVFDLEEPNQSHF

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfolobus islandicus (strain M.16.27)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.336 kDa
Sequence
MTSNEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLRQLINAEFAILQTCNRVEIYLYSNTNTISEINKMIQYLNNVHNEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAIKVGRKVREETSISKGKVGIYSLAIDEAKRQFNNFYDRKIVIVGAGEMGQKIANMLYNEGVKNVTIMNRTVEKAKQLALKFGYNYEKLDLDKLGSFDIAFISISHENLRLENKWNTLIVDITVPPLFTGNNVITLEELEKISKLNFKAREEELVKINKLVEDGIDELIYDYKKEIYSEFMSKIMKRVETIRENEIVRAYKELEKLGINNQQVKEILDLMTRSIIKKSFQPLFDNVRSLVFDGENSINYINFLIDIFKDGNIPIFETKKIKKKQISKRSSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.336 kDa
Sequence
MTSNEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLRQLINAEFAILQTCNRVEIYLYSNTNTISEINKMIQYLNNVHNEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAIKVGRKVREETSISKGKVGIYSLAIDEAKRQFNNFYDRKIVIVGAGEMGQKIANMLYNEGVKNVTIMNRTVEKAKQLALKFGYNYEKLDLDKLGSFDIAFISISHENLRLENKWNTLIVDITVPPLFTGNNVITLEELEKISKLNFKAREEELVKINKLVEDGIDELIYDYKKEIYSEFMSKIMKRVETIRENEIVRAYKELEKLGINNQQVKEILDLMTRSIIKKSFQPLFDNVRSLVFDGENSINYINFLIDIFKDGNIPIFETKKIKKKQISKRSSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.336 kDa
Sequence
MTSNEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLRQLINAEFAILQTCNRVEIYLYSNTNTISEINKMIQYLNNVHNEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAIKVGRKVREETSISKGKVGIYSLAIDEAKRQFNNFYDRKIVIVGAGEMGQKIANMLYNEGVKNVTIMNRTVEKAKQLALKFGYNYEKLDLDKLGSFDIAFISISHENLRLENKWNTLIVDITVPPLFTGNNVITLEELEKISKLNFKAREEELVKINKLVEDGIDELIYDYKKEIYSEFMSKIMKRVETIRENEIVRAYKELEKLGINNQQVKEILDLMTRSIIKKSFQPLFDNVRSLVFDGENSINYINFLIDIFKDGNIPIFETKKIKKKQISKRSSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.336 kDa
Sequence
MTSNEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLRQLINAEFAILQTCNRVEIYLYSNTNTISEINKMIQYLNNVHNEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAIKVGRKVREETSISKGKVGIYSLAIDEAKRQFNNFYDRKIVIVGAGEMGQKIANMLYNEGVKNVTIMNRTVEKAKQLALKFGYNYEKLDLDKLGSFDIAFISISHENLRLENKWNTLIVDITVPPLFTGNNVITLEELEKISKLNFKAREEELVKINKLVEDGIDELIYDYKKEIYSEFMSKIMKRVETIRENEIVRAYKELEKLGINNQQVKEILDLMTRSIIKKSFQPLFDNVRSLVFDGENSINYINFLIDIFKDGNIPIFETKKIKKKQISKRSSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.336 kDa
Sequence
MTSNEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLRQLINAEFAILQTCNRVEIYLYSNTNTISEINKMIQYLNNVHNEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAIKVGRKVREETSISKGKVGIYSLAIDEAKRQFNNFYDRKIVIVGAGEMGQKIANMLYNEGVKNVTIMNRTVEKAKQLALKFGYNYEKLDLDKLGSFDIAFISISHENLRLENKWNTLIVDITVPPLFTGNNVITLEELEKISKLNFKAREEELVKINKLVEDGIDELIYDYKKEIYSEFMSKIMKRVETIRENEIVRAYKELEKLGINNQQVKEILDLMTRSIIKKSFQPLFDNVRSLVFDGENSINYINFLIDIFKDGNIPIFETKKIKKKQISKRSSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.336 kDa
Sequence
MTSNEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLRQLINAEFAILQTCNRVEIYLYSNTNTISEINKMIQYLNNVHNEPIGNQARVICGKDSIKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQILFERAIKVGRKVREETSISKGKVGIYSLAIDEAKRQFNNFYDRKIVIVGAGEMGQKIANMLYNEGVKNVTIMNRTVEKAKQLALKFGYNYEKLDLDKLGSFDIAFISISHENLRLENKWNTLIVDITVPPLFTGNNVITLEELEKISKLNFKAREEELVKINKLVEDGIDELIYDYKKEIYSEFMSKIMKRVETIRENEIVRAYKELEKLGINNQQVKEILDLMTRSIIKKSFQPLFDNVRSLVFDGENSINYINFLIDIFKDGNIPIFETKKIKKKQISKRSSS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.322 kDa
Sequence
MTLKMIGCSHHDAAVEIREQLSFTENEINRTFELFGQRFADAELVLLSTCNRVELYGAGSNPASLQSDDLIDLVADCLNQSRDFVANHMIIREGREAVEHLFLVAASLDSMVVGEAQILSQVKQSYDLANDADRTGPITHGVFQAANRTAKRVQTETSIHRRRLSVPSVAIGEVVPEVFNRLQGKRVVLCGAGEMAEETLRYLKNGGANNLCVVNRSLDRAQKLADEFGADAESMDSLHDQIVQADLLIGTTSAEEPIVDASTFAALNAKRGGRIMLVLDLAVPRDFDPVIGDEPGVYLYQIDDLQAACNRNRREREKQWPKAKKIIDEEVDGFFQSLQQRATGPVIRRLRERADKVKAEELQRLFGKLNGSTDTAMQKEIEKSFDRLTNKLLHPPMASLRDDAADGHSRGLLEALRHLFNLGEDS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobaculum parvum (strain NCIB 8327)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.142 kDa
Sequence
MNIISVGVNHKTAPIEIRERIALSEVQNKEFVTDLVSSGLASEAMVVSTCNRTELYVVPGMPEVNCDYLKDYIISYKDARNAVRPEHFFNRFYCGTARHLFEVSSAIDSLVLGEGQILGQVKDAYRIAAEVGTAGILLTRLCHTAFSVAKKVKTRTKLMEGAVSVSYAAVELAQKIFSNLSMKKVLLIGAGETGELAAKHMYAKNARNIVITNRTQSKAEALAEELGTNRVLPYESYKEHLHEFDIIITAVSTKEYILNAAEMQQSMAKRRLKPVIILDLGLPRNVDPEVGALQNMFLKDIDALKHIIDKNLERRRAELPKVKSIIDEELIGFGQWINTLKVRPTIVDLQSKFIEIKEKELERYRHKVSEEELKRMEHLTDRILKKILHHPIKMLKAPVDTADNIPSKVNLVRNIFDLEEPNQSLQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobium phaeobacteroides (strain BS1)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.451 kDa
Sequence
MNIISVGVNHKTAPIEIRERLSLSEVQAKEFLTNLIDDGIAQEAMVVSTCNRTELYVVPGMPEVDGNYMKEFLISYKDAQGEVRPEHFFNRFYCNTARHLFEVSSAVDSLILGEGQILGQVKNAYRIAVEVQSAGILLTRLCHTAFSVAKKVKTKTKIMEGAVSVSYAAVELAQKIFSNLSIKKILLVGAGETGELAAKHMFQKNARNIVITNRTLSKAEALAEELGTNQVLPYESYKDHLHEFDIIITAVSSKEYVLTEPELQQSMQKRRLKPVIILDLGLPRNVDPEIGNLKNMFLKDIDALKHIIDKNLEMRKCELPKVKKIIDEELVGFAQWINTLKVRPTIVDLQSKFLEIKEKELERFRYKVSDAELKRMERLTDRILKKILHHPIKMLKAPVDTADTIPSRVNLVRNIFDLEEQNRLSK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.133 kDa
Sequence
MNIISVGVNHKTAPIEIRERIALSEVQNKELVTDLVSSGLASEAMVVSTCNRTELYVVPGMPEVNCDYLKDYIISYKNARNAVRPEHFFSRFYCGTARHLFEVSCAIDSLVLGEGQILGQVKNAYRIAAEVGTAGILLTRLCHTAFSVAKKVKTRTKLMEGAVSVSYAAVELAQKIFSNLSMKKVLLIGAGETGELAAKHMYAKNARNIVITNRTQSKAEALAEELGTNRVLPYESYKEHLHEFDIIITAVSTKEYILNAAEMQQSMAKRRLKPVIILDLGLPRNVDPEVGALQNMFLKDIDALKHIIDKNLERRRAELPKVKAIIDEELVAFGQWLNTLKVRPTIVDLQSKFLEIKEKELERYRYKVSEEELRRMEHLTDRILKKILHHPIKMLKAPVDTADNIPSKVNLVRNIFDLEEPNQSLQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
49.422 kDa
Sequence
MSKDEELLQNYCSILFTYKTIGISNLHLYYFRETEIKSLKQLINAEFAILQTCNRVEIYLYSDTNTLKEVNKIIQYLNNIHNEPIGNQARVLCGKDAAKHLFLVASGADSLSIGEYEILSQIRSTIDMFKKLGFSGKYLQIFFERAIKVGRKVREETSISKGKVGIYSLAIDEAKKRFNDFYDRRILVIGAGEMAQKITSMLHNEGAKDVTIMNRTIEKAKQLALKFGYNYEKLDLDKLGNFDVAFISIYHENLRLENKWNTLIVDITVPPLFTGNNVITLEELERISNLNFKAREEELAKINKLVEDGINELLYDYKKEIYTEFMSKIMKRIETIRENEILRAYKELEKLGINDQQAKEILDLMTRSIIKKSFQPLFDNIRSLIFNGENSINYINFLIDIFKDGNISGFETEKIKEKQVSERSSI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermosynechococcus elongatus (strain BP-1)
Length
426 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.597 kDa
Sequence
MNIAVIGLSHKTAPVDVREKLSVPEDVRERALQHLCGYAHIQEATILSTCNRLEIYIVTSDTEVGVREVHQFLSEWSHIPLPQLRPYLFILLHQDAVMHLMRVASGLDSLVIGEGQILSQVKRCHQLGQQYKSIGPILNRVFTGAIAAGKRVRTETSIGTGAVSISSAAVELADLRLQNLQNCRIAVVGAGKMSRLVVQHLIARGVKEIRIINRSLERAQELAQQFPEVRFELFTMTDLLPIVAAMDLVFTSTAATEPLLDRDNLGAVLVGDRSLAIIDISVPRNVHANVTELGTVQLFNVDDLQAVVAQNQEARRQLAQEAEGILEEELETFLAWWHALETVPIIRSLRQKMEAIRTQELEKALSRLGSEFADKHQGVIEAMTRTIINKILHDPTVQLQSQRDLESRQRAMQTLQDLFNLEPIEA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.121 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVEALQQLCHLTESREAAILSTCNRSELYIEHEHLGADSILAWLANYHHLSLEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQRSQALLIGAGETITLVARHLHDLGVKRIVVANRTLERASMLAAEFGAHAVLLSDIPAELVNSDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAALAAEQLVSVGAEDFMSRLRELAAVDVLRAYRQQSERLRDEELSKAQRMLANGSNAEDVLIQLARGLTNKLLHAPSVQLKKLSAEGRVDALAMAQELFALGEGSTDKTPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas entomophila (strain L48)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.312 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVDALQQLCRLTASREAAILSTCNRSELYIEQDHIAADAVLQWLADYHQLSLDELRASAYIHEEHDAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLGRSQALLIGAGETITLVARHLHEQGVRRIVVANRTLERASILAEQFGAHAVLLADIPQELANSDIVISSTASQLPILGKGAVESALKQRRHKPIFMVDIAVPRDIEPQVGELDDVYLYTVDDLHEVVAENLKSRQGAAQAAEELVSAGADDFMVRLRELAAVDVLKAYRQQSERLRDEELQKALRLLGNGGNPEDVLMQLARGLTNKLLHAPSVQLKKLSAEGRLDALAMAQELFALHEGSTDKTPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.32 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVDALQQLCRLTSSREAAILSTCNRSELYIEQDHLSADAVLQWLADYHRLSLDELRASAYVHEEHEAVKHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFADLGRSQALLIGAGETITLVARHLHEQGVRRIVVANRTLERASILAEQFGAHAVLLADIPQELANSDIVISSTASQLPILGKGAVESALKQRRHKPIFMVDIAVPRDIETEVGELDDVYLYTVDDLHDVVAENLKSRQGAAQAAEELVSVGAEDFMLRLRELAAVDVLRAYRQQSERLRDEELQKALRLLANGGNPEDVLAQLARGLTNKLLHAPSVQLKKLSAEGRLDALAMAQELFALNEGSTDKSPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas putida (strain GB-1)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.293 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVDALQQLCRLTSSREAAILSTCNRSELYIEQDHLSADAVLQWLADYHRLSLDELRASAYVHEEHDAVKHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFADLGRSQALLIGAGETITLVARHLHEQGVRRIVVANRTLERASILAEQFGAHAVLLADIPQELANSDIVISSTASQLPILGKGAVESALKQRRHKPIFMVDIAVPRDIETEVGELDDVYLYTVDDLHDVVAENLKSRQGAAQAAEELVTVGAEDFMLRLRELAAVDVLKAYRQQSERLRDEELQKAQRLLANGGNPEDVLAQLARGLTNKLLHAPSVQLKKLSAEGRVDALAMAQELFALNEGSTDKSPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.306 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVDALQQLCRLTSSREAAILSTCNRSELYIEQDHLSADAVLQWLADYHRLSIDELRASAYVHEEHDAVKHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFADLGRSQALLIGAGETITLVARHLHEQGVRRIVVANRTLERASILAEQFGAHAVLLADIPQELANSDIVISSTASQLPILGKGAVESALKQRRHKPIFMVDIAVPRDIETEVGELDDVYLYTVDDLHDVVAENLKSRQGAAQAAEELVSVGAEDFMLRLRELAAVDVLRAYRQQSERLRDEELQKALRLLANGGNPEDVLAQLARGLTNKLLHAPSVQLKKLSAEGRLDALAMAQELFALNEGSTDKSPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.224 kDa
Sequence
MISNFKSISLTYRKAPLEIRERVALNEAECKSLMLRIKDFTDTAELLILSTCNRTEIYYTSNEDYSNDIIKLLGVEKNITGLIQQKEYFEIYNEQADAVLHLFEVGIGLDSQVVGDMQIVNQVKYAYQWSADLNLAGPFLHRLMHTIFFTNKRVVQETAFRDGAASVSYATVELSEELLSATPNANILIVGLGEIGADVCRNFKANTSFKNITLTNRSPLKSEALAAECGIEHVPFETLWEAVAKADLVISSVAKEEPLFTKEEIQKLSILSHKYFIDLSVPRSVDARAEELPGIIVYDIDHIQNRSNEALENRLNAIPHVRKIILDSIVEFNEWSKEMEVSPTINKLKNALEQIRKEELSRFVKQLSDEEAKKVDEITKSIMQKIIKLPVLQLKAACKRGEAETLIDVLNDLFNLDKQPEQIRD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.224 kDa
Sequence
MISNFKSISLTYRKAPLEIRERVALNEAECKSLMLRIKDFTDTAELLILSTCNRTEIYYTSNEDYSNDIIKLLGVEKNITGLIQQKEYFEIYNEQADAVLHLFEVGIGLDSQVVGDMQIVNQVKYAYQWSADLNLAGPFLHRLMHTIFFTNKRVVQETAFRDGAASVSYATVELSEELLSATPNANILIVGLGEIGADVCRNFKANTSFKNITLTNRSPLKSEALAAECGIEHVPFETLWEAVAKADLVISSVAKEEPLFTKEEIQKLSILSHKYFIDLSVPRSVDARAEELPGIIVYDIDHIQNRSNEALENRLNAIPHVRKIILDSIVEFNEWSKEMEVSPTINKLKNALEQIRKEELSRFVKQLSDEEAKKVDEITKSIMQKIIKLPVLQLKAACKRGEAETLIDVLNDLFNLDKQPEQIRD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas putida (strain W619)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.431 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVDALQQLCRLTASREAAILSTCNRSELYIEQDQLSAEAVLQWLADYHRLSLDELRASAYIHEEHDAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLARQIFSDLGRSQALLIGAGETITLVARHLHEQGVRRIVVANRTLERASLLAEQFGAHAVLLADIPQELAHSDIVISSTASQLPILGKGAVESALKQRRHKPIFMVDIAVPRDIEPEVGELDDVYLYTVDDLHEVVAENLKSRQGAAQAAEELVSVGAEDFMVRLRELAAVDVLRAYRQQSERLRDEELQKAQRLLANGGNPEDVLAQLARGLTNKLLHAPSVQLKKLSAEGRLDALAMAQELFALNEGSTDKSLQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.089 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVDALQQLCHLTESREAAILSTCNRSELYIEHEHLGADSILAWLANYHHLSLEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQRSQALLIGAGETITLVARHLHDLGVKRIVVANRTLERASILAAEFGAHAVLLSDIPAELVNSDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAALAAEQLVSVGAEDFMSRLRELAAVDVLRAYRQQSERLRDEELSKAQRMLANGSNAEDVLIQLARGLTNKLLHAPSVQLKKLSAEGRVDALAMAQELFALGEGSTDKTPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas syringae pv. syringae (strain B728a)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.107 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVEALQQLCQLTQSREAAILSTCNRSELYIEHEHLGADSILAWLANYHHLSLEELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQRSQALLIGAGETITLVARHLHDLGVKRIVVANRTLERASMLAAEFGAHAVLLSDIPAELVNSDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAALAAEQLVSVGAEDFMSRLRELAAVDVLRAYRQQSERLRDEELSKAQRMLANGSNAEDVLIQLARGLTNKLLHAPSVQLKKLSAEGRVDALAMAQELFALGEGSTDKPPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobium luteolum (strain DSM 273 / 2530)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.247 kDa
Sequence
MNIISVGVNHKTAPIEIRERISLSEVQNKEFITGLISGGLAHEAMVLSTCNRTELYVVPAMHEVTGEYLKDYIISFRDARKDVRPEHFFSRFYCGTARHLFEVSSAIDSLILGEGQILGQVKEAYRIAAEVQAAGILITRLCHTAFSVAKKVKTKTKIMEGAVSVSYAAVELAQKIFSNLSMKKILLVGAGETGELAAKHMFAKNARNIVITNRTQSKAEALAEELGTNRVLPFESYKEHLHEFDIIITAVSTKDYIITEADMHGAMQKRRLKPVIILDLGLPRNADPEIGKLQNMFLKDIDALKHIIDKNLERRSLELPKVHSIIDEELVAFGQWINTLKVRPTIVDLQSKFIEIKEKELERYRYKVSEEELRRMEHLTDRIMKKILHHPIKMLKAPISTSDNMPSRVDLVRNVFDLEEPNQSH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobium phaeobacteroides (strain DSM 266)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.386 kDa
Sequence
MNIISVGVNHKTAPIEIRERISLSEVQNKEFITDLISSGLAHEAMVISTCNRTELYVVPAMHEVTGEYLKEYLIAYKDARKEVRPEHFFSRFYCGTARHLFEVSSAIDSLILGEGQILGQVKDAYRISAEVQAAGILLTRLCHTAFSVAKKVKTKTKIMEGAVSVSYAAVELAQKIFSNLSMKKILLIGAGETGELAAKHMFQKNARNIVITNRTLSKAEALAEELGTKKVLPFESYKDYLHEFDIIITAVSTKEYVLSEAEMHQTMMKRRLKPVIILDLGLPRNVDPDIAKLQNMFLKDIDALKHIIDKNLERRSAELPKVNAIIEEELIAFGQWINTLKVRPTIVDLQSKFIEIKEKELERYRYKVSEDELARMEHLTDRILKKILHHPIKMLKAPIDTANNIPSRVNLVRNVFDLEEPNQQH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.142 kDa
Sequence
MNIISVGVNHKTAPIEIRERISLSEVQNKEFVTGLVSAGIAHEAMVLSTCNRTEIYVVPAMHEVTGEYLKDYIISFREAGKDVRPEHFFSRFYCGTARHLFEVSSAIDSLILGEGQILGQVKEAYRIAAEVQTAGILLTRLCHTAFSVAKKVKTRTKIMEGAVSVSYAAVELAQKIFSNLSMKKVLLVGAGETGELAAKHMFAKNARNIVITNRTRSKSEALAEELGTNQVLPYESYKEHLHEFDIIITAVSTKEYIISEAEMHAAMLKRRLKPVIILDLGLPRNVDPEVSKVQNMFLKDIDALKHIIDKNLERRSGELPKVHAIIDEELVAFGQWINTLKVRPTIVDLQSKFIEIKEKEIERYRHKVSEEELRRMEHLTDRIMKKILHHPIKMLKAPISTSDSMPSRVDLVRNVFDLEEPNQSH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.118 kDa
Sequence
MHITLIGVHQRNTPVTVRERLAFSLRELPDALLALRRYVEEGIILSTCNRVEVCAVTHDSVGGDAALKSFLAEQRGVDQAVFVPSLYIYHNEAVVRHLYRLAAGLDSMVLGEDQIVGQIKEALAIAHASGAIGPVLHRVLHGALAAGKRARTHTGIASGHVSVVSVAIDALRQHADLLKQGRALVIGAGHMAELTLKHLIAEGCSAITVINRTETRASALAQRYGVAWRPWGDLSDALAMSDMVVSCTSAPGIVVSWQMVERAAVGRSVPLLLFDLAVPRDIDQRVVEIPGVHLYDVDALEPICVTNRAMRAAEAQRAEAIIDGEVAKFMEWWVAQQAVPTIRALRERAEAIRDAEIRRALARCPELSPQQRETVVALSTAIINKLLHEPIVALRDPEAGSELVSAVRRLFNIDDATVHPSAKVT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Roseiflexus sp. (strain RS-1)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.193 kDa
Sequence
MQITLIGVHQRNTPVTVRERLAFNLYELPDALLALRRYVDEGIILSTCNRVEVCAVTRNGVAGDEALKTFLVEQRGVDQALFAPSLYVYHNEAVVRHLYRLAAGLDSMVLGEDQIVGQVKEALAIAHAAGAIGPVLHRVLHGALAAGKRARTHTGIATGHVSVVSVAIDAMRQYPDLLKRGRALVIGAGHIAELSLKHLLAGGCSAITIVNRTEARADALAQRYGVAWRPWSDLEDALAASDIVVSCTSAPGIVLSQQMVERAAAGRSTPLLLFDLAVPRDIDQGVAEIPGVYLHDVDALEPICRTNRALRAAEAERAETIIEGEVAKFMEWWAVQQAVPTIRALRKRAEDIRDAEIRRALARCPELSPQQRETVIALSTAIINKLLHEPIVALRDPEASGELLTAVRRLFNIDDTAVYTSANMT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.361 kDa
Sequence
MTLIALGINHNTASLDVREKVAFSSTQIESALRAAIAGAGLSEVAILSTCNRTELYAYGSSQANSLIQWLAEYKQVNVAELEQSHYLYTASEAASHMMKVASGLDSLVLGEPQILGQMKSAYAVAREAGVLGGHLHDVFQRVFSVAKRVRSETAIGENPVSVAYAAVSLAQQIFSDLKQDTALLIGAGETIELVARHLAEQGIKKLIVANRTLGNARSLAEQFGAEAILLADIPEHLHRADIVISSTASQLPLLGKGAVEQALKRRRHKPMFMVDIAVPRDIEAQVGDLADVYLYTVDDLKEVIDENMRSRQQAAKIAEEIIVEGLLHYEREQRALTSVDTIKALRQTMDALREQELEKSRKALEAGADPAQVLEQLARSLTNKFLHTPSTQLKQAGADGEQDMLRTVRTLFSLPSANESKSEKE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Length
425 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.548 kDa
Sequence
MNIVVVGLSHKTAPVEIREKLSIQEAKMDEAIAHLKSYPHVEEVAVISTCNRLEIYAVVQETEQGVREICQFLAETGQLQLNRLRRYLFTLLHQDAIRHLLRVAAGLESLVLGEGQILAQVKAAHKLGQQHKGLGRLLDRMFKRAITAGKRVRSETNIGTGAVSISSAAVELAQMKVKDLSNQKIAIIGAGKMSRLLVQHLVSKGAEDITIVNRSERGARDLAKKFPDVDLQLELLPEMLNVVEQADIVFTSTGATEPILDRAKLENLDLHTLILIDISVPLNVAADVEEIAGVRLYNVDALKEVVAQNQASRRKMAEEAEALLEEEVENYIQWWQSLETVPTISSLRSKVESIREQELEKALSRLGAEFEEKHQEVIETLTRGIVNKILHDPMVQLRAQQDIEARRVCLQSLQMLFNLETEEAI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Alkaliphilus metalliredigens (strain QYMF)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.297 kDa
Sequence
MKIIVFGITHKKATIDLREKVAFSQSKKQEAYSLLKESPFIHEAVILSTCNRSEVFAVVQDTSIARRWFKRFYTDFFQLKETALEGCNHFEKGREAVQYLYHVCVGVDSLVIGEDQILGQVKEAHAEALDFAATGKILNKLFLEAVTTAKEVKTETAISENALSISSIAVKQMENHLKGLVGKTVLVVGFGKMSRIAIENLLCKGIKRLYICNRTKESVQELIEKHPQIHYLSYDQKYEMLNGVDAVISATGAPHFIFYKEDMEKIYQKHRPMCMIDIALPRDIDPAVKEIEGIELFHIDDLKEIANENLAYRMDCIEIIKQSINEAIEKYEGWYQCLPIYPRIQAIKAYSETLTDQELEKLFKRLDHMAEEDRQVIEVVVKSLVKKMWKTPILQLKDAGIRGNGEAFAAFVDEFLGLDAGCGK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.19 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPEQLVEALQQLCRLTDSREAAILSTCNRSELYIEQDHLSADVVLRWLAEYHHLSLDELRASAYVHEDDAAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSAAKQVRTDTAIGENPVSVAFAAVSLAKQIFSDLQRSQALLIGAGETITLVARHLHDLGVKRIVVANRTLERASLLAEQFGAHAVLLSDIPQELVHSDIVISSTASQLPILGKGAVESALKLRKHKPIFMVDIAVPRDIEPEVGELDDVYLYTVDDLHEVVAENLKSRQGAAQAAEELVNIGAEDFMVRLRELAAVDVLKAYRQQSERLRDEELQKALRMLANGSGAEDVLAQLARGLTNKLLHAPSVQLKKLSAEGRLDALAMAQELFALGEGSSDKTP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.56 kDa
Sequence
MTLLALGINHKTATIEVREQVAFTPAELAGALAELKSLPGVNEAAVLSTCNRTELYCVTDSQGEREVLDWLGRFHALPPETLMQSAYHYLDGEAARHLMRVAAGLDSMVLGEPQILGQLKEAYQLARDNAGLGGELERLFQHTFSVAKQVRSETGIGENPVSVAYAAVSLASHIFDDFGRARALLIGAGETIELVARHLREAGIRGLTVANRTRERAELLAHEVDAEAISLGEIPQALAHADIIISSTASPLPILGKGMVESALKKRRHRPMFMVDIAVPRDIESQVGELDDVFLYSVDDLQEVIEENRKQRAVAAAQAESLIEHGIQHWQHERRVRGAGDLIRRYREQGEALREEAERQALAQLARGEDPEKVLQRLSRQLTNKLLHGPTLRLREASGEARHDILKAADTLLIDPAASTQDSA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.887 kDa
Sequence
MSKHPSRFAVAGVSHHTADVLALEAFRFGDEPAFLAAAQKKFAGALLLQTCNRVEVIVEGDAASLRDFLESQERKGFFLLEGREALRHLFSLAAGIDSMIVGEDQIIGQLKKSLADGEAACTASPFLSLCINKAVHVGVGVRRTTKINRGAVSVGSAAVLLAESELGTLEGRHILVVGSGEMGLLVAQALAAKHLTAMYVANRTFGRAVILAEKIGGVAVRMNELYHYITLSDVVISCTSAPHPVIHKTALKEAMRDRCWPVEGHPRPLILVDIAQPRDVEEGAGAIDGVRLFTIDDLRQVNEQTMSTRRAEAERAAEYVDDELDLFIRQLHRKSADDCIAALHTWAEAVRVRERDRALARLGNMDERTAGVIDDLSRVLTKKILTDATASIRACAEEGDRDAAEALVRALTRGSAADSREGTE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.83 kDa
Sequence
MTHALFSPFTIAGISHHTASVADMESVRFPDEEAFLTRAGDWFKGVILLQTCNRIEIMVHGNADLLGTFLESEGRAGWQMWKDADALSHLLDLAAGLDSMVIGEDQILGQLRKSLSLSESMSVADPLITLCINKAIHAGSEARRISGINRGAVSIGSAAVLLAEEQLGSLAGRHILVLGTGEMGVLVTQALAAKQLSAIYVANRTFDRAQCLAEKVHGTAVPMADLYRYLTMSDVIICCTAAPHPVIKVQEVMEALKGRSWPLDHSRRPLIIVDIAQPRDVEEDVGKIPGVCLYTIDDLRKVNDDTAQFRKEAAEKVREFLDQELVQFIRLFNRKAADELLATLHSWAEQIRIRERDRALSRLSGCDDRVRDVTDDLTRVLTRKLLTDVTLTIRTCAERGEMKIAEDLVGAITRGENICSRTYD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.697 kDa
Sequence
MTRTLLTDIAVATADHSKYGEEVLGLFRFKDETAFFEKASKIFPGVVLLETCNRVEILVHGSAKQLRDFLHGEQRFGFDILEGEAALMHLLELAAGTKSMIIGEDQILGQMRRALLLAESHDTNDVITDVCLNTAIREGVSIRQKTSINKGAVSIGSAAVLLAEELMGDLDGKNILVVGGGEMGTLVARALCEKNLRAIYVTNRSFDRAVLLAEEIKGRAMRLDQLYPCIALSDVVISCTGAPHLIIHADELAETMNERFWPLDLEPRHLLLIDIAQPRDIDDACRDVPGVSLKTLDDLKSISEKNLAARKTECEHADVLVKAALPEFIKAFNRAASGDLTKNLYTWAEEIRQREKNKALSRLRDADPYLESVIDDLTSALTKKLLEDAAKSIRASAECTDTQTAEILLKAIISGEVSCIRRSE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.09 kDa
Sequence
MNPVNDIIDSYSAIVYTHKTVGVDKLASHYLGWNEIKELSKYYDGEMAVLQTCNRIEIYLFSRNESSVNEILHYLNEVHNKVISTDATILRGEEAIKHLFEVASGIDSLSVGEYEILKQIKDAMRDSIKLGIGSRYIRALLERSLKVGRRVRLETGISRGKVGVYSLAVEFAKSRFGDILGKKIAILGAGEIGGKLALILHNEGATDVTIFNRTFERGRNLAIKYGYSYFPLDFSRLHNYDIIFSAIFYPEKVKAPEGTVVIDLGSPPVFEGSNVYTLKDLEELSKATLEERQREIERAESIIREGLEEFRKDCLNLVYDNFVSSFMSRVEETRKEEVERALKVLGDDGEETREVLEAMTRSMIKKIFSPMFQNLRRAVENNEINYINLATSLLTHGGISQDKTKEIKTEQEYKGRSSGDETDS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Legionella pneumophila (strain Paris)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.884 kDa
Sequence
MVFVACGLNHKTAPIHVREKVALQPAMQDSLLSSLLDLPEVNEAAILSTCNRTEIYCDTNTPEVLGNWLAHEHQLSEELLSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIFRASKRIRTRSGIGANPVSIAYAAVQLIGQLFKNYHSLSVFLIGSGETASLVAKYLHQHGVHRFLIASRTLENAQKLAETFGGKTLSIGDIPQYLPLADVVISATACPLPFINKSLVEHALEQRNHAPMFLLDLAVPRDIEGNVNELEQVHLYNVDDLQSMIEKGMDERRNAALQAEQLIESELDNYIRWHRSLRAKDVICDYRNQMHTLAQQELQRALKKISAGQNQQDVLNEFSMRLVNKLTHNPTIGLRQIAWDNREDLLDLARYLFDTTANQSLYEEIS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Legionella pneumophila (strain Corby)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.883 kDa
Sequence
MVFVACGLNHKTAPIHVREKVALQPAMQDSLLSSLLDLPEVNEAAILSTCNRTEIYCDTNTPEVLGNWLAHEHQLSEELLSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIFRASKRIRTRSGIGANPVSIAYAAVQLIGQLFKNYHSLSVFLIGSGETASLVAKYLHQHGVHRFLIASRTLENAQKLAETFGGKTLSIGDIPQYLPLADVVISATACPLPFINKSLVEHALEQRNHAPMFLLDLAVPRDIEGNVNELEQVHLYNVDDLQSMIEKGMNERRNAALQAEQLIESELDNYIRWHRSLRAKDVICDYRNQMHTLAQQELQRALKKISAGQNQQDVLNEFSMRLVNKLTHNPTIGLRQIAWDNREDLLDLARYLFDTTANQSLYEEIS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.884 kDa
Sequence
MVFVACGLNHKTAPIHVREKVALQPAMQDSLLSSLLDLPEVNEAAILSTCNRTEIYCDTNTPEVLGNWLAHEHQLSEELLSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIFRASKRIRTRSGIGANPVSIAYAAVQLIGQLFKNYHSLSVFLIGSGETASLVAKYLHQHGVHRFLIASRTLENAQKLAETFGGKTLSIGDIPQYLPLADVVISATACPLPFINKSLVEHALEQRNHAPMFLLDLAVPRDIEGNVNELEQVHLYNVDDLQSMIEKGMDERRNAALQAEQLIESELDNYIRWHRSLRAKDVICDYRNQMHTLAQQELQRALKKISAGQNQQDVLNEFSMRLVNKLTHNPTIGLRQIAWDNREDLLDLARYLFDTTANQSLYEEIS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Legionella pneumophila (strain Lens)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.96 kDa
Sequence
MVFVACGLNHKTAPIHVREKVALQPAMQDSLLSSLLDLPEVNEAAILSTCNRTEIYCDTNTPEVLGNWLAHEHQLSEELLSQFLYIHQGKEGIKHTLRVASGLDSMMIGEPQILGQMKQAYQHACRLGTVKTQLRPVFEYIFRASKRIRTRSGIGANPVSIAYAAVQLIGQLFKNYHSLSVFLIGSGETASLVAKYLHQHGVHRFLIASRTLENAQKLAETFDGKTLSIGDIPQYLPLADVVISATACPLPFINKSLVEHALEQRNHAPMFLLDLAVPRDIEGNVNELEQVHLYNVDDLQSMIEKGMDERRNAALQAEQLIESELDNYIRWHRSLRAKDVICDYRNQMHTLAQQELQRALKKISAGQNQQDVLNEFSMRLVNKLTHNPTIGLRQMAWDNREDLLDLARYLFDTTANQSLYEEIS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bordetella avium (strain 197N)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.254 kDa
Sequence
MSVAVLAFGLNHTSAPVSVRERVSMPVDLVKPALAGLRSAFGGAVREAAILSTCNRTEVYCAADAAVAEQLPIWLADHHCMEAGSLHPHLYRLHQNDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAAEEAGSLGTLLHQLFQRTFAVAKEVRSQTEIGAHSVSMAAAAVRLAERVFGDLGQARTLFIGAGEMIELCATHFAAQHPRSMVVANRTAERAESLAGRFSAGTMKLADLTERLAEFDVVVSCTASSLPILGLGMVERATRQRRHRPMVMIDLAVPRDIEPEVGRLDDVYLYSVDDLGRLVQSGTDARRAAVVQAEAIIETRVQGFMHWMQSREVVPVIRGLHQAAEDVQAAELERARRLLARGESPEAVLEQLAHGLTQKYLHGPLAALNRSAGDERKQLLAWMPRLFPGRDSRR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.736 kDa
Sequence
MSVAVLAFGLNHTSAPVSVRERVSMPVDLVKPALEGLRATFGGAVREAAILSTCNRTELYCAAEGQVAEHLPAWLAEHNRLEAAALRPHLYRHQHDDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAANEAGALGTLLHQLFQRTFSVAKEVRSQTAIGAHSVSMAAAAVRLAERVFGQLEDARTLFIGAGEMIELCATHFAAQRPRSMVVANRTIERAETLAGRFSAQTMKLADLTERLAEFDVIVSCTASSLPILGLGMVERATRQRRHRPMVMIDLAVPRDIEPEVGRLDDVYLYSVDDLGRLVQSGTDARRAAVVQAEAIIETRVQGFMHWMQSREVVPVIRDLHQAADDVRAAELERARRMLARGESPEAVLEQLAHGLTQKYLHGPLAALNRSEGDERRQLLAWVPRLFPGRDSRR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.736 kDa
Sequence
MSVAVLAFGLNHTSAPVSVRERVSMPVDLVKPALEGLRATFGGAVREAAILSTCNRTELYCAAEGQVAEHLPAWLAEHNRLEAAALRPHLYRHQHDDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAANEAGALGTLLHQLFQRTFSVAKEVRSQTAIGAHSVSMAAAAVRLAERVFGQLEDARTLFIGAGEMIELCATHFAAQRPRSMVVANRTIERAETLAGRFSAQTMKLADLTERLAEFDVIVSCTASSLPILGLGMVERATRQRRHRPMVMIDLAVPRDIEPEVGRLDDVYLYSVDDLGRLVQSGTDARRAAVVQAEAIIETRVQGFMHWMQSREVVPVIRDLHQAADDVRAAELERARRMLARGESPEAVLEQLAHGLTQKYLHGPLAALNRSEGDERRQLLAWVPRLFPGRDSRR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.766 kDa
Sequence
MSVAVLAFGLNHTSAPVSVRERVSMPVDLVKPALEGLRATFGGAVREAAILSTCNRTELYCAAEGQVAEHLPAWLAEHNRLEAAALRPHLYRHQHDDAVRHAFRVASGLDSMVLGEPQILGQMKDAVRAANEAGALGTLLHQLFQRTFSVAKEVRSQTAIGAHSVSMAATAVRLAERVFGQLEDARTLFIGAGEMIELCATHFAAQRPRSMVVANRTIERAETLAGRFSAQTMKLADLTERLAEFDVIVSCTASSLPILGLGMVERATRQRRHRPMVMIDLAVPRDIEPEVGRLDDVYLYSVDDLGRLVQSGTDARRAAVVQAEAIIETRVQGFMHWMQSREVVPVIRDLHQAADDVRAAELERARRMLARGESPEAVLEQLAHGLTQKYLHGPLAALNRSEGDERRQLLAWVPRLFPGRDSRR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Hahella chejuensis (strain KCTC 2396)
Length
424 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.84 kDa
Sequence
MALFVISINHKTAPVAIREKVAFGPEKLADALERLRCRPDIDEVTILSTCNRTELYCATPGEPDEISLIEWLGQYHQVSLTELKACCNIYNDEDAAQHMMRVASGIDSMVLGEPQILGQMKEAHASGRAAGSLGGPLDRLFQHAFAVAKRVRTETAIGENPVSVAYAAVSMASHIFSNMEQNTALLIGAGETIELVARHLYRAGVRSLIVANRTLSRARDLAAEFHGSAIGLSDIPEYLHRADIVIASTASPLPILGKGAVEKALKRRKHKPMFMVDIAVPRDIEEEVSELADVYLYTVDDLRQVIEDNMKSREGAAEEAERLIAAGAADFMYHLRALDSVSVLRRFRDQAEGVRDAELQKAIRLLNRGDDPESVLRMLAHGLTNKLIHHPTVQVRRASAEGRQEVTGWLRDLFQLPDEKVNND

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Length
423 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.521 kDa
Sequence
MTLIAFGINHKTAPVELREKVAFSPDAMVEALKSLAHLTGADESVIVSTCNRTEIYAQAENLTADALTTWLAEFHQAKADELGLNSYIYHQEDAIKHIMRVACGLDSLILGEPQILGQVKQAFVSAKDSGVIKSDFERLFQQTFSVAKRVRSETEIGSNAVSVAYASVQLAKHIFSSLKKSNVLLIGAGETIELVAKHMHEQGVKKLSVANRTLARAEAIAQPLGATTLTLTQIPAHLKDADIVISSTASQLPILGKGLVERALKDRRHKPMFLVDLAVPRDIEAEVGELDDAYLYTVDDLQQIVEKNIESRQHAALQAQQMIEEQAQQYMLWRQGQSSIDVLRDFRQQSESQRDTLIAKALNQLADGKEAEQVIKELANKLTNSLIHAPTKALKKAAMQQDNKNMSLLQDALGLARANDSSK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Syntrophus aciditrophicus (strain SB)
Length
423 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.114 kDa
Sequence
MGILLIGMSHKTSPLAVRERFSLSCENRDHPLDRIRQMPSIREALYLATCNRVEVLVSAAEEAEQAVEEGLKALMAERGGISGQELERCLYTLSGAEAVRHLFRVASSLDSLVMGEPQILGQVKEAYREAVEHGVTGILLNRILHHAFQVAKRVRTETGIADNAVSVGYAAVELAKKIFGRLDGKVILLVGAGEMSELAARHLLKQGIKSIFVANRTHARALEMAEQFEGKAVVLEQVPEVLKSVDIVISSTGASNYVLTRDMVAAALRRRKNRFLFLIDIAVPRDIEPAAGDIDNVYLYNIDHLQELVDENRNHRLREAEKAEAIIEEEVGNHTAWLSTLDVVPTIVEFREKIEGIMKAELGKSASWRHSLSEIDQRHVESLMASIVNKILHEPTACLREQSRNRNGKAYAAALRKLFKLER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Length
423 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.688 kDa
Sequence
MTISALGINHKTASVDLREQVAFSAEQLDAALQAVRNLQGVEEAVIVSTCNRTELYCRGEVSGDLLLGWLTGFHKLAPNALENHHYHFQGEQAITHLMSVASGLDSLVLGEPQILGQVKQAYQAAKRQASVGGILERLFQQTFRVAKTVRNETAVGQNAVSVAYAAVSMARHIFANLQKSKVLLIGAGDTSELVAQHLKQQGVTEILVANRTLQRASEMAERVGATAHSLSELSELLPQADIVVSSTASTLPIVGKGSIEKALKKRRHRPMLLIDLAVPRDIEEQVNELDDAYLYTVDDLQSIISENIRNREQAAREAQVIIQQQTKEFNDWLKSLNSVELVREYRTHTKTLADEQLKKALAQIEQGKDPAEVLQRFSHRLVQQLTHKPTSLLKSAGENNDQYTLAVLQQLWSEPSSDSSKGK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Length
423 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.18 kDa
Sequence
MNIISVGVNHKTAPIEIRERIALSEVQNKEFITDLISSGLAHEAMVVSTCNRTELYVVPAMTEVTGEYLKEYLISFKDARKEVRPEHFFSRFYCGTARHLFEVSSAIDSLVLGEGQILGQVKDAYRIAAEVQAAGILITRLCHTAFSVAKKVKTKTKIMEGAVSVSYAAVELAQKIFSNLSMKKILLIGAGETGELAAKHMCQKNARNIVITNRTLSKAEALAEELGTGKVLPFESYKEYLHEFDIIITAVSTKEYVLREAEMHQSMQKRRLKPVIILDLGLPRNVDPDISRLQNMFLKDIDALKHIIDKNLEKRRGELPKVQAIIEEELVSFGQWINTLKVRPTIVDLQSKFIEIKEKELERYRYKVSEEELRRMEHLTERILKKILHHPIKMLKAPIDTSDSIPSRVNLVRNIFDLEEPNQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Length
423 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.577 kDa
Sequence
MPELFTIPLALAGISHHAADIATLEAFRFPDEAAFLHEARERFRGVLLLQTCNRIEVLVQGDARSLEGFLQEKGRHGFTVIEGEAVPRHLLELAAGIDSLIVGEDQILGQLKQALAAAEEAGTCCSAIGLCIKKAVHAGVRVRRQTQINRGAVSVGSAAVTLAENLLGTLRDRHILVVGSGEMGVLVAQALAARGLTAIYVANRTYERAVMLADKIGGRAVNFKDLYRYIALSDVVISCTAAPHPVIRTEDIRAVMEERLWPLDTHPRHLILIDIAQPRDVEEGVRSIEGVHLFTIDDLRNVNDATMESRRSEADRARGIIDEEAEHFVRLLRRAAADETLALLYTWAESIRARERDRALARLRERDDRTAEVIDDLTHALTNKILSDVTTAIRACAECGDITTAEALMRAITRGEPCFQNEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas aeruginosa (strain PA7)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.122 kDa
Sequence
MAFIALGINHKTASVAVRERVAFTPEQMVEALQQLCRLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADYHRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSTAKTVRTDTAIGENPVSVAFAAVSLAKQIFSDLHRSQALLIGAGETITLVARHLFEQGVKRIVVANRTLERASLLAEQFGAHAVLLSEIPEELANSDIVISSTASQLPILGKGAVERALKQRKHKPMFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAAQAAEELVGSGVTEFMQRLRELAAVDVLRAYRQQAERLRDDELGKAQRQLANGADPAEVLAQLARGLTNKLLHAPSVQMKKMSAEGRIDALALAQELFALDEGAPRH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas aeruginosa (strain LESB58)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.124 kDa
Sequence
MAFIALGINHKTASVAVRERVAFTPEQMVEALQQLCRLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADYHRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSTAKTVRTDTAIGENPVSVAFAAVSLAKQIFSDLHRSQALLIGAGETITLVARHLFEQGVKRIVVANRTLERASLLAEQFGAHAVLLSEIPEELANSDIVISSTASQLPILGKGAVERALKQRKHKPMFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAAQAAEELVGSGVAEFMQRLRELAAVDVLRAYRQQAERLRDEELGKAQRQLANGADPAEVMAQLARGLTNKLLHAPSVQMKKMSAEGRIDALALAQELFALDEGAPRH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas aeruginosa (strain UCBPP-PA14)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.124 kDa
Sequence
MAFIALGINHKTASVAVRERVAFTPEQMVEALQQLCRLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADYHRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSTAKTVRTDTAIGENPVSVAFAAVSLAKQIFSDLHRSQALLIGAGETITLVARHLFEQGVKRIVVANRTLERASLLAEQFGAHAVLLSEIPEELANSDIVISSTASQLPILGKGAVERALKQRKHKPMFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAAQAAEELVGSGVAEFMQRLRELAAVDVLRAYRQQAERLRDEELGKAQRQLANGADPAEVMAQLARGLTNKLLHAPSVQMKKMSAEGRIDALALAQELFALDEGAPRH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.124 kDa
Sequence
MAFIALGINHKTASVAVRERVAFTPEQMVEALQQLCRLTTSREAAILSTCNRSELYLEIDHPTADDVLAWLADYHRLTLDELRACAYVHQDEDAVRHMMRVASGLDSMVLGEPQILGQMKSAYAVAREAGTVGPLLGRLFQATFSTAKTVRTDTAIGENPVSVAFAAVSLAKQIFSDLHRSQALLIGAGETITLVARHLFEQGVKRIVVANRTLERASLLAEQFGAHAVLLSEIPEELANSDIVISSTASQLPILGKGAVERALKQRKHKPMFMVDIAVPRDIEPEVGELDDVYLYSVDDLHEVVAENLKSRQGAAQAAEELVGSGVAEFMQRLRELAAVDVLRAYRQQAERLRDEELGKAQRQLANGADPAEVMAQLARGLTNKLLHAPSVQMKKMSAEGRIDALALAQELFALDEGAPRH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Campylobacter fetus subsp. fetus (strain 82-40)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.142 kDa
Sequence
MHYVSISFTHKNTDIGVREKLSFSDNNRRREILRLIGANDSIAESMALSTCNRVEIFAYVLDTQSSIRHILNSISILTLVPFEALELRADIYEDQGAIHHLFAVASSLDSLVVGETQIAGQLKEAFKFAYDNEDCGVNISSAMHFAFKCAAEVRALTTISKNPVSVSSVAVAKAKEIYGNIGGMSAVVIGAGEMSRLAAQHLINAEVNVIIINRDEIKAQTLAKELGELASYASFDKLSEYINRYRLIFSATGAPNAIITNEIIEQKDFHRYFFDIAVPRDIDIEEDEYIHVYAVDDLEEIVRTNLALREEQASIAYSIVGKSTTSFFKWRLSEGSTPAIKALRLKAKDIACKEIEKAVKKGYLKCSDQDEASKLVHQVFKAFLHTPSVRLKEKNSDDILKALEYLFDIKIQKDENLEGNLK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudomonas stutzeri (strain A1501)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.95 kDa
Sequence
MAFLALGINHKTASVDVRERVAFTPDQMVEALRQLCRVTPTREAAILSTCNRSELYLQQDEVEAEAVLAWLASYHRLSLDELKACAYVHVDDQAVRHMMRVASGLDSLVLGEPQILGQMKSAYAVAREAGSVGPLLGRLFQATFSTAKTVRTDTAIGENPVSVAFAAVSLARQIFSNLQRSQALLIGAGETITLVARHLHEQGVKRIVVANRTLERASALAAELGAHAILLADIPDELHNSDIVISSTASQLPILGKGAVEQALKRRKHKPMFMVDIAVPRDIESQVGELDDVYLYTVDDLHEVVAENLKSRQGAAQAAEELVAAGTEDFMQRLRELAAVDVLKAYRQHAERIRDDELSKAQRLLANGASAEDALAQLARGLTNKLLHAPSVQLKKLSAEGRVEALSMAQELFALHEGTEKP

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.205 kDa
Sequence
MTEISSMVITHAKATVEEMEDSWHGDIDLVLSQLYSNELVYECAVLKTCNRVEIYVVSSKGSSVLFHYAKEMGVSAKIVEFYDHDESLRHLLRLACGLESMIIGEDQILGQIKDFFLMAKGAGTVGKVLSTAFSKAIQVGKRVRTETFINRGAVSIASAAVDLAEDILDGLNDKHILVIGTGEMGTLVTRALSHRDMHVIYLANRTYEKARDLAEELGGEAVMFDQLEKYVRAADVVISATSAPHYVLKGDLVAKVMEGRENELLLIDIASPRDIDPAVEEIPHVILRNIDGLRVINEKNLQMRMVEAKKAEIIIDDELDMVKAQYKRQKADAIISNLYSQSHGLRHNEMEHAINKLSAYHTIGEIERKVLEDLTHAITNKILAEPTKKLRNAAEYDDDKFLDSVSRLFDIRPIKKNDGITK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Marinomonas sp. (strain MWYL1)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.233 kDa
Sequence
MPLITVGINHKTAPVSIRERVAFAPEKMIDALSSLISENKANEAVIVSTCNRTELYCSVEDLSKVDDVIAWLGKYHGIALPELQQYCYTHADDDSVRHVMRVASGLDSLILGEPQILGQVKSAYAVSQEGSCIGPELESLFQRTFSVAKRVRTDTAIGENPVSIAFAAVSLAQRIFADIRNSTALLIGAGQTIELVARHLKENGIKHIIVANRTLARAQILADELNAEAIMLGDIGDYLSQADIVISSTASQLPIIGKGMVERATSQRRHSPMLLIDIAVPRDIEPEVEEVNDAYLYTVDDLHSVIEENVRARQDAAKAAEQMIEEGVDSYRRVVESRKVSDLIVTFRQSAEAIKNTELEKALKGLEMGQSPEQVLNKLAHGLMNKLIHAPTRYLRDAGADADQDALIIASNVLGIYEEKDN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Length
422 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.447 kDa
Sequence
MSIVAVGINHKTAPVAVREKISFNPDKLSIALQEMLNAVQCREVAILSTCNRTELYLVQDGDFDVTQQRLIKWLESFHNVPASTILPSLYWHKDQQAVNHMMRVACGLDSLVLGEPQILGQMKQAYSQAKAAGSMSLIMDRLFQRTFGVAKQVRTETEIGASAVSVAFASVNLAKHIFGGLEKTKVLLVGAGETIELVAKHLYENNVGKITVANRTLARAENMATKIGADVITLAQIPEHMCNADIVISSTGSTLPIIGKGMVEQALASRKHQPIFMVDLAVPRDIEEQVSELEDVFLYTVDDLQGIIAKNIANRRKAAVQAESIVNSQSDNFMAWLRGLNTQDTVISYRKQCLDNRDVLLEKAFIQLKNGKNSEAVLAELANKLTNKFMHAPTSALQSAAQGGELDKLIYLRDIFNIDSQE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Lactobacillus reuteri (strain DSM 20016)
Length
421 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.865 kDa
Sequence
MYLMCVSLNYHQLPLDLREKFSFTKEEVPKADKLLNDEKSILENLLISTCNRTEVYAVVDQIHTGRYYIRRFLAEWFHYTIDDFTKFVTVTTKDAVAEHLFKVITGLDSLIKGEPQILGQMKDAFQIATKEGTTGAILNHLFRQAITFSKRMHTKYRVSELAQSSGQAGLHQIKMQFGSLEGKTLAVVGLGQIGKHTAYNASNMGFSKVLLLNRTDSKAEQIATELQGVVEARPFNQLATVVHNVDAAIFAATVKQPLFKADEQISTMIVDLGVPRNVAVNSTKLKYYDVDHVHMILNSNDEKRRLMIQKIANEIPQEVNDFYIWEKQLHIVPVIRGLREHSLRIEGEAYDSLLRKLPELDSHERKVISKHMKSIVNQMIKGPIKEIKELSVTPGATADIDFFCKIFGMDNLKVENQNNDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Lactobacillus reuteri (strain JCM 1112)
Length
421 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.865 kDa
Sequence
MYLMCVSLNYHQLPLDLREKFSFTKEEVPKADKLLNDEKSILENLLISTCNRTEVYAVVDQIHTGRYYIRRFLAEWFHYTIDDFTKFVTVTTKDAVAEHLFKVITGLDSLIKGEPQILGQMKDAFQIATKEGTTGAILNHLFRQAITFSKRMHTKYRVSELAQSSGQAGLHQIKMQFGSLEGKTLAVVGLGQIGKHTAYNASNMGFSKVLLLNRTDSKAEQIATELQGVVEARPFNQLATVVHNVDAAIFAATVKQPLFKADEQISTMIVDLGVPRNVAVNSTKLKYYDVDHVHMILNSNDEKRRLMIQKIANEIPQEVNDFYIWEKQLHIVPVIRGLREHSLRIEGEAYDSLLRKLPELDSHERKVISKHMKSIVNQMIKGPIKEIKELSVTPGATADIDFFCKIFGMDNLKVENQNNDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Length
421 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.617 kDa
Sequence
MKLVVVGLNHKSAPVSLREKVAYSSDTLPRSLQALTRLDAVHEGTILSTCNRVEIYMASRDPDAAAAQTSQWIARDHALDPADVTPHLYTKAESEAVRHGFCVASSLDSMVLGEAQILGQMKQAYQDALSAGSTGVVLNRFFQHAFLTAKRVRTETSIAENSVSVASAAVDLAKRIFGDLSGHSCLLIGAGEMCELAARHLVTHGVKEVLVTNRTFSRAVDLAQQFDGHAFPIEALAENLHRADIVISSTGSTVYMVGPDMVKQALKSRRQRPIFLIDIAVPRDLDPEIGQVDSAFLYDMDDLNKIVNDNRQDRAEAAQAAMQIIEGETPLFIQWLDTLDVVPTIKQMRRKAEAAKDQLLQKHLAGWDLSDTDRQRVENLARQLVNKLMHDPTERLRSLTNEHDGDRYIDAARKLYKLDDD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Solibacter usitatus (strain Ellin6076)
Length
421 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.431 kDa
Sequence
MKLLITGVSHKTAPVEVRECLAFREETLPAALADLKACEGVSEAVILSTCNRVEISLTTEDAVDPREIVDNFLSRHKAVSSASIGPHLYRHEGRDAIHHLFRVAASLDSMVVGEPQILGQLKVAYAAAKDCGALCGWLDGLMSRSFSVAKRVRSETGIGQMAVSVSYAAVELARKIFGSLTNRTVMIVGAGKMSELAARHLRRSGASHVFVTNRTHERAVDMAKLFQGTPVEYARFTAMLPEVDILIASSGAPHYILHKDEMQRVISARRNKPMFLIDIAVPRNIEPAINDLDNVFLYDIDDLQEVVNSNLRERMKEADHAELLVTEEVDRMMARMKVAEVTPVIVSLQEQLEQIRSGEMEKVRRRFGPFTAQQEEALEALTRGIINKVAHGPISELRSQAGKPDGAPAIAAIRKAFHLQD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Edwardsiella ictaluri (strain 93-146)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.408 kDa
Sequence
MSLLALGINHKTAPVSLRERVTFSPDTLDRAIESLLRQPSVQAGVVLSTCNRTELYLSVEQRADLRQQIVDWLCSYHQLTPEEVSDSLYWHQDNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFSESQREQALSADLERLFQKTFSVAKRVRTETEIGTSAVSVAFAACTLARQIFESLARLNVLLVGAGETIELVARHLHQHQVQHMMIANRTRERAQSLADEVGAEVIPLADIDARLADADIVISSTASPLPIIGKGMVERALKARRNRPMLLVDIAVPRDIEPEVGDLANAYLYSVDDLHAIIQGNMAQRQEAAVQAEHIVQQECANFMAWLRAQGAVDTIREYRAQAEQRRAEAESEALAALAQGVEAEAVIRRLAHRLTNRLIHAPTKSLQQAAGSGDAQRLQMLRDSLGLDHN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Yersinia pseudotuberculosis serotype I (strain IP32953)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.66 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPESMDQALNSLLQQPLVQGGVVLSTCNRTELYLSVEQQENLHEQLTAWLCNYHKLSPDDVRQSLYWHHGNDAVRHLMRVASGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERLFQKSFSVAKRVRTETEIGASAVSVAFAACSLARQIFESLSELHVLLVGAGETIELVARHLREHQVKHMIIANRTRERAQSLASEVGAEVITLPEIDARLADADIIISSTASPLPIIGKGMVERALKTRRNQPMLFIDIAVPRDIEPEVGKLSNAYLYSVDDLQAIIQHNMAQRQAAAVQAESIVQQESMNFMTWLRAQGAVETIRDYRSQAEQVRSEMTAKALVAIEQGANVEQVINELAYKLTNRLIHAPTKSLQQAASDGDMERLQLLRDSLGLDQH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.993 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTIGEALDNLLQHPLVKGGVVLSTCNRTELYLSVEQQDNLYEQLIGWLCEYHQLNPRELKSSIYWHCDNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESQHSHSLSSELERLFQKSFSVAKRIRTETEIGSNAVSVAFAACTLARQIFESLSELNILLVGAGETIELAARHLREHRVHHMMIANRTKEKAQVLADEVQAEVITLPEIDIRLAEADIVISSTASPLPIIGKGMVERALKLRRNQPMLLVDIAVPRDIEPDVEKLNNVYLYSVDDLQAIIQQNLAQRKAAAVQAECIVQQESRYFMDWLRSQSAVNSIREYRNQAEQMRAEMAAKALTAINQGADVEQAINQLTHQLMNRLIHAPTKSLQQAASNGDLERLNLLRDSLGLEHN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Photobacterium profundum (strain SS9)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.335 kDa
Sequence
MTLLALGINHNTASVDLREKVAFSPDKLKEALQQLESHPEVTSSIIVSTCNRTEVYCDVTHSGPGVMIDWLAKFHRLSAEEILPSLYFHEEQAAARHLMRVACGLDSLVLGEPQILGQVKQSYYSSQEYDAIHGTLEKLFHKTFTVAKRVRTETDIGGNAVSVAYAACTLAKQIFESLSDTTVLLVGAGETIELVSRHLVEQGCNKLIVANRTKERAANLAEEFGAEVIGLPEIPEHLHRADIVISSTASPLPIVGKGMVEKAIKARRHQPMLFVDIAVPRDVEAEVGDLNDVYLYTVDDLHSIIEKNREQRKVAAIQAEAIISEESAAFMSWLRSLEAVDSIRQYRCFADDIKNDMLSRSLQAIANGVAPEKVLVELSNKLTNKLIHAPTRAMQQAAHNGEPEKLSVIRETLGLDSIKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Proteus mirabilis (strain HI4320)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.819 kDa
Sequence
MTLLALGINHKTAPVALREKVSFSPDTMGDALNNLLQQPAVRGGVVLSTCNRTELYLSLEDKENSHEQLISWLCQYHQIEPHELKNSVYWHQDNQAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQNYHSLSSELERLFQKSFSVAKRVRTETQIGANAVSVAFAACTLARQIFESLSSLTILLVGAGETIELVARHLREHQVKKIIIANRTKERAQRLANEVDAEVITLSDIDESLSQADIVISSTASPLPIIGKGMVERALKKRRNQPMLLVDIAVPRDIEQDIEKLSNVYLYSVDDLEAIIQHNREQRQAAAIEAEHIVQQESGQFMDWLRAQGAVGAIREYRDSAEMLRAEMAEKAIALIQNGADAEKVIQQLSHQLMNRLIHTPTKSLQQAASDGDIERLNLLRESLGITHN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Wigglesworthia glossinidia brevipalpis
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.815 kDa
Sequence
MKLLVFGISYKTAPISLRERVIFSPENINIALNNLLKKSDILGGVILSTCNRTEVYLSIKNFYKAKKIIILWLYKFFNDLKIKEIKNNFYSYIDNYAVSHLMRVTSGLDSMILGEHQILSQVKSAFFRSLKNKNISIDLQKLFESAFSVAKKIRSETKIGSYSISIPYIICVLLKKIFISFTEIKVMLIGSGTINELIAKQLFKYKIKDLFISNRTIDHAKNLAIKVNGCVVEFNEIFKNLNKMQVIITSTYSRKLIITYKIIKSIIEKNKNKKIIFIDISIPRNIDKKIKKITGVHLYTLEDLKDLITNNLEKRKNAATLAENIIKKESIKFMSHIKGYYSSEIIKKYRFQINKLKKIYEKKALLELKLGNNPENIIKKLTYKLTNRLVHKPTKLLYNTSCSKNNKDLYDLYNKLKIDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.993 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTIGEALDNLLQHPLVKGGVVLSTCNRTELYLSVEQQDNLYEQLIGWLCEYHQLNPRELKSSIYWHCDNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESQHSHSLSSELERLFQKSFSVAKRIRTETEIGSNAVSVAFAACTLARQIFESLSELNILLVGAGETIELAARHLREHRVHHMMIANRTKEKAQVLADEVQAEVITLPEIDIRLAEADIVISSTASPLPIIGKGMVERALKLRRNQPMLLVDIAVPRDIEPDVEKLNNVYLYSVDDLQAIIQQNLAQRKAAAVQAECIVQQESRYFMDWLRSQSAVNSIREYRNQAEQMRAEMAAKALTAINQGADVEQAINQLTHQLMNRLIHAPTKSLQQAASNGDLERLNLLRDSLGLEHN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Photobacterium profundum (strain SS9)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.335 kDa
Sequence
MTLLALGINHNTASVDLREKVAFSPDKLKEALQQLESHPEVTSSIIVSTCNRTEVYCDVTHSGPGVMIDWLAKFHRLSAEEILPSLYFHEEQAAARHLMRVACGLDSLVLGEPQILGQVKQSYYSSQEYDAIHGTLEKLFHKTFTVAKRVRTETDIGGNAVSVAYAACTLAKQIFESLSDTTVLLVGAGETIELVSRHLVEQGCNKLIVANRTKERAANLAEEFGAEVIGLPEIPEHLHRADIVISSTASPLPIVGKGMVEKAIKARRHQPMLFVDIAVPRDVEAEVGDLNDVYLYTVDDLHSIIEKNREQRKVAAIQAEAIISEESAAFMSWLRSLEAVDSIRQYRCFADDIKNDMLSRSLQAIANGVAPEKVLVELSNKLTNKLIHAPTRAMQQAAHNGEPEKLSVIRETLGLDSIKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Proteus mirabilis (strain HI4320)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.819 kDa
Sequence
MTLLALGINHKTAPVALREKVSFSPDTMGDALNNLLQQPAVRGGVVLSTCNRTELYLSLEDKENSHEQLISWLCQYHQIEPHELKNSVYWHQDNQAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQNYHSLSSELERLFQKSFSVAKRVRTETQIGANAVSVAFAACTLARQIFESLSSLTILLVGAGETIELVARHLREHQVKKIIIANRTKERAQRLANEVDAEVITLSDIDESLSQADIVISSTASPLPIIGKGMVERALKKRRNQPMLLVDIAVPRDIEQDIEKLSNVYLYSVDDLEAIIQHNREQRQAAAIEAEHIVQQESGQFMDWLRAQGAVGAIREYRDSAEMLRAEMAEKAIALIQNGADAEKVIQQLSHQLMNRLIHTPTKSLQQAASDGDIERLNLLRESLGITHN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Wigglesworthia glossinidia brevipalpis
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
48.815 kDa
Sequence
MKLLVFGISYKTAPISLRERVIFSPENINIALNNLLKKSDILGGVILSTCNRTEVYLSIKNFYKAKKIIILWLYKFFNDLKIKEIKNNFYSYIDNYAVSHLMRVTSGLDSMILGEHQILSQVKSAFFRSLKNKNISIDLQKLFESAFSVAKKIRSETKIGSYSISIPYIICVLLKKIFISFTEIKVMLIGSGTINELIAKQLFKYKIKDLFISNRTIDHAKNLAIKVNGCVVEFNEIFKNLNKMQVIITSTYSRKLIITYKIIKSIIEKNKNKKIIFIDISIPRNIDKKIKKITGVHLYTLEDLKDLITNNLEKRKNAATLAENIIKKESIKFMSHIKGYYSSEIIKKYRFQINKLKKIYEKKALLELKLGNNPENIIKKLTYKLTNRLVHKPTKLLYNTSCSKNNKDLYDLYNKLKIDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Serratia proteamaculans (strain 568)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.452 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPESIEQALTSLLQQPLVQGGVVLSTCNRTELYLSVEQQEHIHEQLVSWLCEYHHLRPEEVSKSLYWHHGNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESQRGQSLSGELERLFQKSFSVAKRVRTETEIGASAVSVAFAACTLARQIFESLAELNVLLVGAGETIELVARHLREHKVRHMIIANRTRERAQLLADEVGAEVITLPEIDERLADADIIISSTASPLPIIGKGMVERALKARRNQPMLLVDIAVPRDIEPEVGKLANAYLYSVDDLHAIIQSNLAQRKAAAVQAESIVQQESINFMAWLRSQGAVETIRDYRSQADQIRAEMEAKALAAIAQGADVEQVIHELAHRLTNRLIHAPTKSLQQAAGDGDVERLQLLRDSLGLDQH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.942 kDa
Sequence
MAILTLGVNHTTAPVSIRERLAFPAEQLQSALRDLIDLPQVGEAAILSTCNRTEVYCELDGRDQRPIVDWMCDQRQFDDQDISQYLYSHFDAGTIRHMFRVACGLDSMILGEPQILGQMKTAYQAAREAGTVGKILTKLFHRTFAAAKKVRTDTAIGCSPVSVAFAAIRLAQRIFDDLGDLTAILVGAGETIELTARHLTENRIGHLIIANRTFDRAHTLANQFGGFAISLEELPKHLAKADIIVASTGSPLPILGKGSFESALRSRRHKPMFIVDLAVPRDIEPEVEQLQDVYLYTVDDLQHTVEENLKTRQEAALQAEEIIDLEVEHFLSWLRAQAATETIRDVRRQAELHRDAALQRALRELRRGKSAEDTLRWLADTLTNKIIHAPSSQIWQAGVNERADIVAAARELFQLKDPDT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sodalis glossinidius (strain morsitans)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.591 kDa
Sequence
MTLLALGINHKTAPVALRERVAFSPETLDQALGSLLAHPLVQGGVVLSTCNRTELYLSVEQQADLQEALVRWLCDYHQLEPDEVRQSLYWHLGDEAVSHLMRVASGLDSLVLGEPQILGQVKKAFAESRRGHGLSVDLERWFQKSFSVAKRVRTETEIGSHAVSVAFAACTLARQIFESLADVTVLLVGAGETIELVARHLREHKVKRLLIANRTPERAQRLAEDVGADVINLAEIDSQLGEADIIITSTASTLPIIGKGMVERALKQRRYQPMLLVDIAVPRDIEPEVAKLADAYLYTVDDLQAIIEKNLAQRKHAAVLAETIVAQESMDFMGWLRSQSAVEAIRDYRTQADSLREEFEARALAALRLGADPEQVVKDMAYKLTNRLIHTPTKSLQQAAREGDAERLQILRDGLGLDTH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.106 kDa
Sequence
MSSTQLFAFGINHQTAPLDVREQVSFPADAMEHALHDLVSHRPVREAAIVSTCNRTEIYCSTDKPDEATHWLADFHRLPTRELEPYLYRLPREKAVKHAFRVASGLDSMVLGEPQILGQLKDAVKSAEHAGTLGMLLHKLFQRTFFVAKEVRSSTEIGTNSVSMAAASTRLAERIFGDIGEQRVLFIGAGEMIELCASHFAARHPKRITVANRTVERAQALAHRLNGQVITLNELPDQLALHDIVVTCTASTLPILGKGMLERAIKARKHRPIFMVDLAVPRDVEPEVAELDDVFLYSVDDLADIVKEGLDSRQGAVAQAEAIIDSNVVNFMHWLESRQVVPTIRALRDQAERYRRHELERAKKLLAKGEDPRKIIESLSNGLTNKFLHLPSYALNHAAEDERDDLVDLISRLYHLHPSE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)
Length
420 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.445 kDa
Sequence
MQLLAFGVNHKTASVAIREQITFAPERLPSALTELVNRSGAKEAAILSTCNRTELYCGCAPGQQEAVIEWLRQYHGMEPKILETCLYTHPDHSAVRHLLRVASGLDSMVLGEPQILGQIKAAYSYGLEAGTIGRVLGRLFQHTFYVAKQVRTDTAIGTSPISVAFAAVSLAKQIFGDLESTTAFLIGAGETIELAARHLFTNGVGHIIVANRNLDKAYQLANQFNGYAIPLAEMPKHLSEADIVISSTGSQLPILGKGTVERALRIRKHRPIFMVDIAVPRDIEPEVGELQDIYLYNVDDLQEVVQENLRSRQAAALQAEEIIDTQVEYFMDWVRTQDAVPVICAVRQEADQLRKEALEKARRRLAQGHDPNEVLTMLAHNLTNKLMHVPTRQLRSLGATGDELALQAALKIFDVDHFKA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.547 kDa
Sequence
MSLLALGINHNTASVALRERVAFGPDCIDRALRELVAQPGVSEAVIVSTCNRTELYCSLAQGQGEQVLQWLQRFHGLDAAEVVSAIYQHQDEEAVRHLMRVACGLDSLVLGEPQILGQIKQSYAHAQQSEAVKGSLERLFQKSFSVAKRVRTDTEIGASAVSVAFAAVSLGRRIFSDLSQTKVLLVGAGETIELVARHLREQNVTQMMVANRTLQRAQLLAEEFGAQVMTLEEIPDYLHEADIVISSTASPLPIIGKGMVERALKARRFKPMFLVDIAVPRDIEAEVDELSDAYLYTVDDLQGIIEQNLETRKRAAAEAELIVQEERDDFMGWYRSQHSVDLIRDYRHQSQQVADEELQRALLALQQGENAEQALKALAHRLTNKLIHAPTQALRHAAAQGDHHQLAQLRQMLGLSQES

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.744 kDa
Sequence
MSLLAIGINHNTASVELREKVAFGPEKLSLALNQLSTSSHVKGGVILSTCNRTEIYCDVRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCKRMIVANRTRERALSLAQQFGADVIALNEIPDYLAQADIVISSTASPLPIIGKGMVESALKARRHQPMLLVDIAVPRDIEPQVGKLNDAYLYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSLQAVDSIRDYRKQANEAREELLNKSLQALAAGGDPEKLLIELSNKLTNKLIHTPTRALQTAAEQGEPAKLAVIRQSLGLDDLN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.744 kDa
Sequence
MSLLAIGINHNTASVELREKVAFGPEKLSLALNQLSTSSHVKGGVILSTCNRTEIYCDVRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCKRMIVANRTRERALSLAQQFGADVIALNEIPDYLAQADIVISSTASPLPIIGKGMVESALKARRHQPMLLVDIAVPRDIEPQVGKLNDAYLYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSLQAVDSIRDYRKQANEAREELLNKSLQALAAGGDPEKLLIELSNKLTNKLIHTPTRALQTAAEQGEPAKLAVIRQSLGLDDLN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio cholerae serotype O1 (strain M66-2)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.744 kDa
Sequence
MSLLAIGINHNTASVELREKVAFGPEKLSLALNQLSTSSHVKGGVILSTCNRTEIYCDVRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCKRMIVANRTRERALSLAQQFGADVIALNEIPDYLAQADIVISSTASPLPIIGKGMVESALKARRHQPMLLVDIAVPRDIEPQVGKLNDAYLYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSLQAVDSIRDYRKQANEAREELLNKSLQALAAGGDPEKLLIELSNKLTNKLIHTPTRALQTAAEQGEPAKLAVIRQSLGLDDLN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio tasmaniensis (strain LGP32)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.591 kDa
Sequence
MSLLAVGINHNTASVELREKVAFGPDKLSEALKQLNANAHVNGSVILSTCNRTEVYCDVKGVAKNKLIDWLSVFHQVSPEELKPSIYIHEEQAAIKHLMRVACGLDSLVLGEPQILGQVKQAYTDSRDNKSVDASMEKLFQKSFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESIAESTVLLVGAGETIELVAKHLSANGCTKMIVANRTRERALGLAEEFGAEVISLNEIPDHLHRADIVISSTASPLPIIGKGMVETALKTRKHQPMLLVDIAVPRDVESQVGDLNDAYLYSVDDLQSIVDGNIEQRKVEAIQAEAIVSEESAAFMSWMRSLQAVDSIRDYRKSANEIREELLSKSLQSLAAGGDPEKVLLELSNKLTNKLIHAPTRALQSAAEQGEPAKLTVIRQSLGLENPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio vulnificus (strain CMCP6)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.058 kDa
Sequence
MSLLAIGINHHTASVDLREKVAFGPDKLANALQQLSQHEAVNGSVILSTCNRTEVYCDVKSGARSKVIDWLSQFHQIGLEELKPSLYVYEEQAAIRHLMRVSCGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLEKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLEKSTVLLVGAGETIELVAKHLHANGCSKMIVANRTRERALTLAEQFDAQVISLQEIPNHLAKADIVISSTASPLPIIGKGMVETALKQRRHQPMLLVDIAVPRDVEAQVGDLNDAYLYTVDDLQSIIDSNIEQRKVEAIQAEAIVAEESAAFMSWLRSLQAVDSIREYRQSANEIREDLLSKALLSLESGSDPEKVLRELSNRLTNKLIHAPTRALQLAAEQGEPAKLTVIRQSLGLDELK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio vulnificus (strain YJ016)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.055 kDa
Sequence
MSLLAIGINHHTASVDLREKVAFGPDKLANALQQLSQHEAVNGSVILSTCNRTEVYCDVKSGARSKVIDWLSQFHQIGLEELKPSLYVYEEQAAIRHLMRVSCGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLEKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLEKSTVLLVGAGETIELVAKHLHANGCSKMIVANRTRERALTLAEQFDAQVISLQDIPNHLAKADIVISSTASPLPIIGKGMVETALKQRRHQPMLLVDIAVPRDVEAQVGELNDAYLYTVDDLQSIIDNNIEQRKVEAIQAEAIVAEESAAFMSWLRSLQAVDSIREYRQSANDIREELLSKALLSLESGGDPEKVLRELSNRLTNKLIHAPTRALQLAAEQGEPAKLTVIRQSLGLDELK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.744 kDa
Sequence
MSLLAIGINHNTASVELREKVAFGPEKLSLALNQLSTSSHVKGGVILSTCNRTEIYCDVRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCKRMIVANRTRERALSLAQQFGADVIALNEIPDYLAQADIVISSTASPLPIIGKGMVESALKARRHQPMLLVDIAVPRDIEPQVGKLNDAYLYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSLQAVDSIRDYRKQANEAREELLNKSLQALAAGGDPEKLLIELSNKLTNKLIHTPTRALQTAAEQGEPAKLAVIRQSLGLDDLN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.744 kDa
Sequence
MSLLAIGINHNTASVELREKVAFGPEKLSLALNQLSTSSHVKGGVILSTCNRTEIYCDVRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCKRMIVANRTRERALSLAQQFGADVIALNEIPDYLAQADIVISSTASPLPIIGKGMVESALKARRHQPMLLVDIAVPRDIEPQVGKLNDAYLYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSLQAVDSIRDYRKQANEAREELLNKSLQALAAGGDPEKLLIELSNKLTNKLIHTPTRALQTAAEQGEPAKLAVIRQSLGLDDLN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio cholerae serotype O1 (strain M66-2)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.744 kDa
Sequence
MSLLAIGINHNTASVELREKVAFGPEKLSLALNQLSTSSHVKGGVILSTCNRTEIYCDVRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVACGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKLFQKAFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCKRMIVANRTRERALSLAQQFGADVIALNEIPDYLAQADIVISSTASPLPIIGKGMVESALKARRHQPMLLVDIAVPRDIEPQVGKLNDAYLYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSLQAVDSIRDYRKQANEAREELLNKSLQALAAGGDPEKLLIELSNKLTNKLIHTPTRALQTAAEQGEPAKLAVIRQSLGLDDLN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio tasmaniensis (strain LGP32)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.591 kDa
Sequence
MSLLAVGINHNTASVELREKVAFGPDKLSEALKQLNANAHVNGSVILSTCNRTEVYCDVKGVAKNKLIDWLSVFHQVSPEELKPSIYIHEEQAAIKHLMRVACGLDSLVLGEPQILGQVKQAYTDSRDNKSVDASMEKLFQKSFSVAKRVRTETEIGGSAVSVAYAACTLAKHIFESIAESTVLLVGAGETIELVAKHLSANGCTKMIVANRTRERALGLAEEFGAEVISLNEIPDHLHRADIVISSTASPLPIIGKGMVETALKTRKHQPMLLVDIAVPRDVESQVGDLNDAYLYSVDDLQSIVDGNIEQRKVEAIQAEAIVSEESAAFMSWMRSLQAVDSIRDYRKSANEIREELLSKSLQSLAAGGDPEKVLLELSNKLTNKLIHAPTRALQSAAEQGEPAKLTVIRQSLGLENPQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio vulnificus (strain CMCP6)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.058 kDa
Sequence
MSLLAIGINHHTASVDLREKVAFGPDKLANALQQLSQHEAVNGSVILSTCNRTEVYCDVKSGARSKVIDWLSQFHQIGLEELKPSLYVYEEQAAIRHLMRVSCGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLEKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLEKSTVLLVGAGETIELVAKHLHANGCSKMIVANRTRERALTLAEQFDAQVISLQEIPNHLAKADIVISSTASPLPIIGKGMVETALKQRRHQPMLLVDIAVPRDVEAQVGDLNDAYLYTVDDLQSIIDSNIEQRKVEAIQAEAIVAEESAAFMSWLRSLQAVDSIREYRQSANEIREDLLSKALLSLESGSDPEKVLRELSNRLTNKLIHAPTRALQLAAEQGEPAKLTVIRQSLGLDELK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio vulnificus (strain YJ016)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.055 kDa
Sequence
MSLLAIGINHHTASVDLREKVAFGPDKLANALQQLSQHEAVNGSVILSTCNRTEVYCDVKSGARSKVIDWLSQFHQIGLEELKPSLYVYEEQAAIRHLMRVSCGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLEKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLEKSTVLLVGAGETIELVAKHLHANGCSKMIVANRTRERALTLAEQFDAQVISLQDIPNHLAKADIVISSTASPLPIIGKGMVETALKQRRHQPMLLVDIAVPRDVEAQVGELNDAYLYTVDDLQSIIDNNIEQRKVEAIQAEAIVAEESAAFMSWLRSLQAVDSIREYRQSANDIREELLSKALLSLESGGDPEKVLRELSNRLTNKLIHAPTRALQLAAEQGEPAKLTVIRQSLGLDELK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Psychromonas ingrahamii (strain 37)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.623 kDa
Sequence
MPLFALGINHQTASVALREKVAFSADLLLDAYQALLAQPTVLEAVIVSTCNRTEIYCHLKQDNCDEVIKWLCSFHQIEDHKLRPSLYCYSEYQAIQHLFRVSCGLDSLVLGEPQILGQIKQAFATAKQAKGVDKIVQKWFQHTFTVAKRVRTETQIGANAISVAFAAVCLAKQIFSDLSQSRVLLIGAGETIELVGKYLIEHQVPNITIANRTLSRAMALVEQFDAQAITLGEIPNHLAQADIIISSTASPLPIIGKGMVERALKARRNRPMLFIDIAVPRDIEAEVSELRDIYLYSVDDLQGIIEENKQARQVAALEAEKIIDGCIVDFISWIESLKAVESIRTYRQNSEQLRDDLLNRASAALQNGEEAENVLKELAFKLTNKLIHHPSLALNETARSGNDDELILLRNALGLSKKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Length
419 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.46 kDa
Sequence
MAVWTLGINHTTAPLDLRGRFAFALDQVEPTLRALRGSLSRQPEAALISTCNRTEIYCAGEKPELEHTLDWLAQTGGVSSSLLRTHSYTLQDDLAARHAFRVASGLDSMVLGETQILGQIKNAVRAAEAAGALGNTLSQLFQRSFAVAKEVRSSTEIGAHSISMAAAAVRLAGQLFEDLGQVKILFVGAGEMIELCATHFAAKSPKAIAIANRSLENGEKLASRFGAEVMRLADLPDRLHEFDAVVSCTASTLPIIGLGAVERALKRRKRRPMFMVDLAVPRDIEIEVKALEDVYLYTVDDLASVVQTAQASRQAAVAQAEAIVDAGVLSFMHWVDQRGSVPLIQQLNAQADEWRAAELARARKLLAKGEDVEAVLEALSKGLTQKMLHGAMTELRASDTAARERASAAIQHFFLRKER

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aeromonas salmonicida (strain A449)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.615 kDa
Sequence
MSLLALGINHNTASVALRERVAFGPDCIDRALRELVTQPGVSEAVIVSTCNRTELYCSLEKGQGEQVLHWLQRFHGLDAAEVVSAIYQHQDEEAVRHLMRVACGLDSLVLGEPQILGQIKQSYAHAQQSEAVKGSLERLFQKSFSVAKRVRTDTEIGASAVSVAFAAVSLGRRIFSDLSQTKVLLVGAGETIELVARHLREQNVTRMMVANRTLQRAQLLAEEFGAQVMTLEEIPDYLHEADIVISSTASPLPIIGKGMVERALKARRFKPMFLVDIAVPRDIEAEVDELSDAYLYTVDDLQGIIEQNLETRKRAAAEAEIIVLEERDEFMGWYRSQHSVDLIRDYRHQAQQVADEELQRALLSLQQGENAEQALKAMAHRLTNKLIHAPTQALRQAAAQGDHHQLSRLRQVLGLPQE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.63 kDa
Sequence
MNLVAVGVNHTTADVELRERLAFSTQQAEVALASLREMPGVREAALLSTCNRTELYCLTDDVTPNFAQWLASSRNLSVERLSTVLYQHTGEQALEHMMRVAGGLDSLVLGEPQILGQMREAYARAHEAGLLNGELSRLFQEVFSVAKRIRTETGIGANPVSVAYAAVSFARHIFADLKKSRALLIGAGEMIELVARHLSEQQVQEITIANRTQERASELAAAVGGRGISLEELPVALERADILISCTAAPLPIMGKGMVERALKKRRHRPMFMVDIAVPRDIEPEVGELGDVYLYTVDHLQEAIQENVRSRQQAAQEASELIRDAIVRHRRQRREQDAVKVLRDYREQRKAMAESELEKALQQLRNGGDAEQVLRRFQHSLVNKWLHSPSVTLRKMAADGRAEALLLARELLLDDDQS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aliivibrio fischeri (strain ATCC 700601 / ES114)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.055 kDa
Sequence
MSLLVIGINHTSASVDLREKVAFSPEKLTKALDELKNSDAIQSGVILSTCNRTEIYCEVKHGISSGYVINWLAEFHHVALETLMPSIYIHEEQAAVKHLMRVSCGLDSLVLGEPQILGQVKKAFADAREHNAVEGTIEKLFQQDFSVAKRVRTETNIGGNAVSVAYAACTLARQIFESLSDSTVLLVGAGETIELVAKHLDDSGCKRLIVANRTRERAMGLAEQFNAEVISLPEIPEHLPKADIIISSTASPLPIIGKGMVESALKLRKHQPMLFVDIAVPRDIEGEVAELNDAYLYSVDDLQSIIDHNIEQRKIEAIQAEAIVSEESAEFMTWIRSRQAVNSIRQYRENSEAMRIELLQKSMQALASGQNPEKVLAELSNKLTNKLIHAPTLAMQQAAKNGETEKLTVIRTTIGLDN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aliivibrio fischeri (strain MJ11)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.067 kDa
Sequence
MSLLVIGINHTSASVDLREKVAFSPEKLTKALDELKNSDAIQSGVILSTCNRTEIYCEVKHGISSGYVINWLAEFHHVALEILMPSIYIHEEQAAVKHLMRVSCGLDSLVLGEPQILGQVKKAFADAREHNAVEGTIEKLFQQDFSVAKRVRTETNIGGNAVSVAYAACTLARQIFESLSDSTVLLVGAGETIELVAKHLDDSGCKRLIVANRTRERAMGLAEQFNAEVISLPEIPEHLPKADIIISSTASPLPIIGKGMVESALKLRKHQPMLFVDIAVPRDIEGEVAELNDAYLYSVDDLQSIIDHNIEQRKIEAIQAEAIVSEESAEFMTWIRSRQAVNSIRQYRENSEAMRIELLQKSMQALASGQNPEKVLAELSNKLTNKLIHAPTLAMQQAAKNGETEKLTVIRTTIGLDN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aliivibrio salmonicida (strain LFI1238)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.894 kDa
Sequence
MSLLVIGINHTSATVDLREKVAFSPDKLTKALDELKNSDAIKSGVILSTCNRTEIYCEVKLGISSGYVINWLAEFHHVALDLLMPSIYIYEEQAAVKHLMRVSCGLDSLVLGEPQILGQVKKAFADAREHNAVEGVVEKLFQSDFSVAKRVRTETNIGGNAVSVAYAACTLARQIFESLAESTVMLVGAGETIELVAKHLNDAGCKQLIVANRTRERAMILADQFNADVISLPEIPEHLSKADIIISSTASPLPIIGKGMVESALKQRRHQPMLFVDIAVPRDIESEVADLNDVYLYSVDDLKSIIDHNIEQRKIEAIQAEAIVSEESAGFMTWIRSRQAVNSIRQYRENSESIRIELLQKSIQALASGQNAEKVLAELSNKLTNKLIHAPTLAMQQAAKNGEPDKLAVIRTSIGLDN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.317 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEERDDLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O81 (strain ED1a)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.294 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEERDDLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQEASEFMAWLRAQSASETIRDYRSQAEQVRDELTAKALAALEQGGDAQTIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O8 (strain IAI1)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.33 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli (strain K12 / MC4100 / BW2952)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.307 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEQVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli (strain K12 / DH10B)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.307 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEQVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O9:H4 (strain HS)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.321 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEQVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O1:K1 / APEC
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.324 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEERDDLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVTRHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQEASEFMAWLRAQSASETIRDYRSQAEQVRDELTAKALAALEQGGDAQTIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.308 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQAGVVLSTCNRTELYLSVEERDDLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQEASEFMAWLRAQSASETIRDYRSQAEQVRDELTAKALAALEQGGDAQTIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.294 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEERDDLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQEASEFMAWLRAQSASETIRDYRSQAEQVRDELTAKALAALEQGGDAQTIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.321 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEQVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli (strain K12)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA). In the absence of NADPH, exhibits substrate esterase activity, leading to the release of glutamate from tRNA.
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.307 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEQVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.307 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEQVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli (strain SE11)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.33 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli (strain SMS-3-5 / SECEC)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.317 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEERDDLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia coli (strain UTI89 / UPEC)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.294 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEERDDLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQEASEFMAWLRAQSASETIRDYRSQAEQVRDELTAKALAALEQGGDAQTIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Enterobacter sp. (strain 638)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.236 kDa
Sequence
MTLLALGINHKTAPVALRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLHEALIRWLCEYHNLNEEELRTSVYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVKHMIIANRTRERAQVLADEVGAEVIALSDIDERLKDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVQAETIVEQESGEFMAWLRAQSASETIREYRGQAEQVRDDLTAKAMAALEQGGDPQVIMQDLAWKLTNRLIHAPTKSLQQAARNGDDERLTILRNSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.078 kDa
Sequence
MTLLALGINHKTAPVALRERVTFTPDTLEQALNSLMAQPLIQGGVVLSTCNRTELYLSVEQQENLQDQLIAWLCDYHQLSPDEVLKSLYWHHGNEAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQRGHSLSGELERMFQKSFSVAKRVRTETEIGASAVSVAFAACTLARQIFESLTTVNVLLVGAGETIELAARHLHQHKVKKLMIANRTRERAQVLAAEVEAEVISLADIDERLAEADIIISSTASPLPIIGKGMVERALKKRRNQPMLLVDIAVPRDVEPDVGKLPNAYLYSVDDLQAIIESNMAQRQAAAVEAETIVVQESSDFMSWLRAQSAVETIREYRAQADEARAELEARAIQSLQQGADAEKVLRDLAHKLTNRLIHAPTKSLQQAARDGDGERLQILRDGLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.346 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMSWLRAQSASETIREYRSQAEHIRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pseudoalteromonas haloplanktis (strain TAC 125)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.338 kDa
Sequence
MTIIALGINHKTAPVELREKVAFSPEQISEALQQLSGHAHFNEAVIVSTCNRTEVYCSLAQQNSQTLLQWLSSFHGLDEHELSKNIYCHEGSDAINHLMRVACGLDSLVLGEPQILGQIKQAYNSAKTHNAVGVTFDRLFQKTFSVAKQVRTETNIGASAVSVAYAAVNLAKHIYGKLDKTNVLLIGAGETIELVAKHLYQNEPQNITVANRTLERARSLADQVSGDVIALAQLPERLHKADIVISSTASTLPIIGKGVVEQALKQRRYKPMLFIDIAVPRDIESQVGELDDAYLYSVDDLQTIVSENMSAREEAAEQAEVIITERTKEFLMWIRSLDSVDLIRHYRNDVQTIKSELVERAVSQLNTGKDAEKVILELANKLTNRLMHAPTRAIQDAAKKGEVAQLNQLKKMLGIDQE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cronobacter sakazakii (strain ATCC BAA-894)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.312 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALESLLSQPMVQGGVVLSTCNRTELYLSVEEQDNLHDKLVRWLCDYHNLDEEEVRNSLYWHHDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSGRGHANASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVMLVGAGETIELAARHLREHNVQKMIIANRTRERAQRLADEVGAEVIGLGDIDERLKDADIIISSTASPLPIIGKGMMERALKARRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIIQHNLAQRKAAAVQAESIVEQEACEFMAWLRAQSVSETIREYRAQADQVREELTSKALAALRTGGDAEAIMQDLARKLTNRLIHTPTKSLQQAARDGDDERLHILRNSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.727 kDa
Sequence
MSLLAIGINHNTASVDLREKVAFGPDKLGPALEQLREHEAVNGSVIVSTCNRTEVYCDVKQGARNKLIDWLAQFHQVNQEDLMPSLYVHEEQAAIKHLMRVSCGLDSLVLGEPQILGQVKQAFSDSRDHQAVDTSIDKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLSDSTVLLVGAGETIELVAKHLASNGCTKMIVANRTRERALGLGEQFGAEVISLNEIPDHLPRADIVISSTASPLPIIGKGMVETALKKRRHQPMLLVDIAVPRDVEAQVGELSDAYLYSVDDLQSIIDSNIEQRKVEAIQAEAIVSEESAAFMTWLRSLQAVDSIRDYRKSANEIREDLLSKSLQSLATGADPEKVLRELSNKLTNKLIHAPTRALQSAAEQGEPAKLTVIRQTLGLDDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.752 kDa
Sequence
MSLLAIGINHNTASVDLREKVAFGPDKLGPALEQLREHEAVNGSVIVSTCNRTELYCDVKQGARNKLIDWLAQFHQVSREDLMPSLYVHEEQAAIKHLMRVSCGLDSLVLGEPQILGQVKQAFSDSRDHQAVDSSIDKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLSDSTVLLVGAGETIELVAKHLASNGCTKMIVANRTKERAQGLAEQFGAEVISLNEIPDYLARADIVISSTASPLPIIGKGMVETALKQRRHQPILLVDIAVPRDVEAQVGELNDAYLYSVDDLQSIIDSNIEQRKVEAIQAEAIVSEESASFMTWLRSLQAVDSIRDYRKSANEIREELLSKSLQSLAAGADPEKVLRELSNKLTNKLIHAPTRALQSAAEQGEPAKLTIIRQTLGLDDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cronobacter sakazakii (strain ATCC BAA-894)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.312 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALESLLSQPMVQGGVVLSTCNRTELYLSVEEQDNLHDKLVRWLCDYHNLDEEEVRNSLYWHHDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSGRGHANASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVMLVGAGETIELAARHLREHNVQKMIIANRTRERAQRLADEVGAEVIGLGDIDERLKDADIIISSTASPLPIIGKGMMERALKARRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIIQHNLAQRKAAAVQAESIVEQEACEFMAWLRAQSVSETIREYRAQADQVREELTSKALAALRTGGDAEAIMQDLARKLTNRLIHTPTKSLQQAARDGDDERLHILRNSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.727 kDa
Sequence
MSLLAIGINHNTASVDLREKVAFGPDKLGPALEQLREHEAVNGSVIVSTCNRTEVYCDVKQGARNKLIDWLAQFHQVNQEDLMPSLYVHEEQAAIKHLMRVSCGLDSLVLGEPQILGQVKQAFSDSRDHQAVDTSIDKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLSDSTVLLVGAGETIELVAKHLASNGCTKMIVANRTRERALGLGEQFGAEVISLNEIPDHLPRADIVISSTASPLPIIGKGMVETALKKRRHQPMLLVDIAVPRDVEAQVGELSDAYLYSVDDLQSIIDSNIEQRKVEAIQAEAIVSEESAAFMTWLRSLQAVDSIRDYRKSANEIREDLLSKSLQSLATGADPEKVLRELSNKLTNKLIHAPTRALQSAAEQGEPAKLTVIRQTLGLDDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.752 kDa
Sequence
MSLLAIGINHNTASVDLREKVAFGPDKLGPALEQLREHEAVNGSVIVSTCNRTELYCDVKQGARNKLIDWLAQFHQVSREDLMPSLYVHEEQAAIKHLMRVSCGLDSLVLGEPQILGQVKQAFSDSRDHQAVDSSIDKLFQKTFSVAKRVRTETDIGGNAVSVAYAACTLAKHIFESLSDSTVLLVGAGETIELVAKHLASNGCTKMIVANRTKERAQGLAEQFGAEVISLNEIPDYLARADIVISSTASPLPIIGKGMVETALKQRRHQPILLVDIAVPRDVEAQVGELNDAYLYSVDDLQSIIDSNIEQRKVEAIQAEAIVSEESASFMTWLRSLQAVDSIRDYRKSANEIREELLSKSLQSLAAGADPEKVLRELSNKLTNKLIHAPTRALQSAAEQGEPAKLTIIRQTLGLDDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Klebsiella pneumoniae (strain 342)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.39 kDa
Sequence
MTLLALGINHKTAPVDLRERVTFSPETLDQALESLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCNYHGLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSSRGHLNVSELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSSVTVLLVGAGETIELVARHLREHHVRKMVIANRTRERAQALADEVGAEVIALSDIDERLKEADIIISSTASPLPIIGKGMVERALKARRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQNIIQHNLAQRKAAAVQAESIVEQETSEFMAWLRAQSASETIREYRSQSEQVREELTAKALAALEQGGDAQEIMQDLARKLTNRLIHAPTKSLQQAARDGDDERLHILRNSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.36 kDa
Sequence
MTLLALGINHKTAPVALRERVTFSPETLDKALESLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCNYHGLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSSRGHLNVSELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSSVTVLLVGAGETIELVARHLREHHVRKMVIANRTRERAQALAEEVGAEVIALSDIDERLKEADIIISSTASPLPIIGKGMVERALKARRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQNIIQHNLAQRKAAAVQAESIVEQETSEFMAWLRAQSASETIREYRSQSEQVREELTAKALAALEQGGDAQEIMQDLARKLTNRLIHAPTKSLQQAARDGDDERLHILRNSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella dublin (strain CT_02021853)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.135 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALTDEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella enteritidis PT4 (strain P125109)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella heidelberg (strain SL476)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella newport (strain SL254)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella paratyphi A (strain AKU_12601)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella schwarzengrund (strain CVM19633)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella typhi
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aromatoleum aromaticum (strain EbN1)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.624 kDa
Sequence
MQLYALGLNHHTAPLTIREQVAFQPERLDDALHDLTHERTVREAAILSTCNRTELYFATEQPQHAADWLARFHHMPLSEVSPYLYTYPQRDAIRHVFRVASGLDSMVLGEPQILGQVKDAVRRAEEAGTMGTLLHKLFQNTFAVAKEVRSTTAIGANIVSMAAAALHLSERIFERMSDQRVLFIGAGEMIELCAAYFAGACPKRIAVANRTEARAQLVAHRFGAEVMRLDVVGEMLPHFDVVVSCTASPLPIVGLGMVERAIKARRHRPIVMVDLAVPRDIEAEVGELDDVFLYTVDDLAQIVDAGLESRQQAVLEAEEIIDSRVNGFLHWMQARDAVPTIRALRQHAETVRAVELERATRLLAKGEDPRKVLDALSHGLINKLMHSPTRYLNQSEGEQQADASRLVQQLFNLSNSPD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.223 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLHASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQVLADEVGAEVISLSDIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQEASEFMAWLRSQSASETIREYRSQSEHVRDELTVKALAALEQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.33 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shigella boydii serotype 4 (strain Sb227)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.33 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shigella dysenteriae serotype 1 (strain Sd197)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.319 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSDVDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEQVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKLLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shigella flexneri serotype 5b (strain 8401)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.358 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFVDSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shigella flexneri
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.358 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFVDSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shigella sonnei (strain Ss046)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.33 kDa
Sequence
MTLLALGINHKTAPVSLRERVSFSPDKLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEEDLRKSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHMKASELERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQILADEVGAEVIALSEIDERLREADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRKAAAVEAETIVAQETSEFMAWLRAQSASETIREYRSQAEHVRDELTAKALAALEQGGDAQAIMQDLAWKLTNRLIHAPTKSLQQAARDGDNERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Gramella forsetii (strain KT0803)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.931 kDa
Sequence
MEDYHISRGKHFYTIGLSYKKADAEIRGHFSLTEESKQRLLEQAKEEGIDGILVTSTCNRTEIYGFAQHPFQLIKLLCEHTHGTVEEFEKVAYVYKNKQAITHIFKVGTGLDSQILGDFEIISQLKIAFVRSKKLGLVNAFLERLVNAVIQASKRIKNETEISTGATSVSFASVQYILKHIDKVSEKNILLFGTGKIGRNTCENLVKHTRNNHITLINRTKDKAERIAGKFNLIVKDYADLQAEIRNSDILIVATGAQNPTISKELIYPKKELLILDLSIPKNVSDDVHELENVKLIHLDHLSQMTDETLEKRKQFIPQAKEIITEVESEFNRWLETRKFAPTIKALKKKLKTMKDDELDFQRKKISDFNDEQAEIVSNRIIQKIMKHFANHLKGDAETTDESLELIQKVFQLEEVNK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella agona (strain SL483)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.105 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLAQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Salmonella choleraesuis (strain SC-B67)
Length
418 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.133 kDa
Sequence
MTLLALGINHKTAPVSLRERVTFSPDTLDQALDSLLAQPMVQGGVVLSTCNRTELYLSVEEQDNLQEALIRWLCDYHNLNEDDLRNSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQVKKAFADSQKGHLNASALERMFQKSFSVAKRVRTETDIGASAVSVAFAACTLARQIFESLSTVTVLLVGAGETIELVARHLREHKVQKMIIANRTRERAQALADEVGAEVISLSDIDARLQDADIIISSTASPLPIIGKGMVERALKSRRNQPMLLVDIAVPRDVEPEVGKLANAYLYSVDDLQSIISHNLVQRQAAAVEAETIVEQEASEFMAWLRAQGASETIREYRSQSEQIRDELTTKALSALQQGGDAQAILQDLAWKLTNRLIHAPTKSLQQAARDGDDERLNILRDSLGLE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Cenarchaeum symbiosum (strain A)
Length
417 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
44.658 kDa
Sequence
MIPGLINARVTFHNSPVHALERFTFRDVGAALEGFRAGSGLDECVIVQTCNRVELFGASASPDMGSIRRTWASLAGIDESLFGGHLESSGGGEVLEHLLRLTSGLDSMVVGEEQILGQVKNAITSARTSGASGRRLNTLFDRAIRSGTRIRNSTGIGSGGVSVGSMAVRLVEENMDDLHSRSILLIGTGEVSTLVAKSLGKRGYDFSVASRTLQRSQAFCSAMGGSPVLFEDVLDGFGGYDVLFVATGAPYFLVTYDKISEVLESRGGMMILDLSNPRTVDEKVATLGGIKLMNLDQIAEMVSKNMRNRMSSVGKVEQMISGEVPVMEAAMNRLDAEPIAEAAFKEADALRRRELAKALQMLGNIGGNDAKVIDDLTRALVESIMSAPMNNLRRASEEGDADVVDAAARLFDYRRPG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Length
417 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.84 kDa
Sequence
MSRITSMLVTHKKASISEIENAWHGDVEALLKWVSSHDTVEECAVLKTCNRVEIYVVSPRGEKVLFEIAKKARVSSRIIDIHDHDESLLHLLRLASGLESMIIGEDQILGQMKELYRTAKSLGYTGWVLDTAFKKAIQVGKRVRKETAINERSVSVGSAAVDLAEQILGGLEGKSVLVIGAGETGELISKALVSKNIGSLYVTNRTFGTALSLAASLGGTAVPYEEMKRKIREADVVISATSAPHYILLKDDIERAMEGRKNKLLIIDIANPRDVDEAVREIEGVELHNIDSLKQISDENMRLRMREIERVEAIIEEELELLRAKYKRREAEELLARIYSEAEKIKEQEVRRAMNKLSAYHTLGEIEQKVLMDMSHSIVNKIFAEPTKALKSAAERGNTEMLRYAMELFRLNQEESD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Streptococcus sanguinis (strain SK36)
Length
417 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.561 kDa
Sequence
MHLLYVGLTHRETPLTILEKAHFSDQEGLKALKLLKREKSILENIILSTCNRTELYLVVDQLHTGRYYSKHFLADWFQIPVKELEEYLVFREGDEALRHLLRVSIGLESKIVGESQVLGQLKQAFLTAQDAGTTGIVLNQAFKQALTFAKRMHDTYRINDRPISIGLTAIQELDRMGLDYSTKKIAVIGLGEIGQLVTKYALQRPFESVMLLNRTVSKAQAFLTEDRVSAHGWDELEEVLADADVVFSAVKTEEYIIFPSMLKEGAIVFDLCLPRSCHPSSSLKLYNIENLTNQLEQYKAERQEIAGRIALEIDEELVKFADWRQQLGIIPLIQEIRDKALEAQASAMESLNRKIPDLTEREQKQISKHMKSIINQVLKEPILQLKELSVGEHSDYDIALIAKIFGLHRERGKDEGH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Azoarcus sp. (strain BH72)
Length
417 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.646 kDa
Sequence
MQLYALGLNHHTAPLAIRERVAFQPDRLDQALQALTDSRTVSEAAILSTCNRTELYFAAEQPQRAADWLAGFHQLPLAQVSPYLYSYPQRDAVRHVFRVASGLDSMVLGEPQILGQVKEAARRAEEAGTLGTLLHKLFQNTFAVAKEVRSTTAIGANIVSMAAAAVHLTGRIFERVSDQHVLFIGAGEMIELCAAHFAGAGPRSMTVANRTEARAEALAARLGAQTMRLDAIADALPRFDVVVSCTASPLPIVGLGMVERAVKVRRHRPIVMVDLAVPRDVEPEVGQLDDVFLYTVDDLAQVVDAGIESRQQAVVEAEGIIDQRVDGFLHWLHARDAVPTIRALREHAETLRRGEIERALRQLAKGEDPQAVLDALSHGLTNKLMHGPTRFLTQAEGEGQAEASRVVQQLFNLSRHD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
Length
417 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.298 kDa
Sequence
MHLLAFGLNHHTAPLSIREKLAFPAETLPRALESLLASQAAREAAIVSTCNRTEIYCSSPDPHAALDWLCQFHGLSRAELEPYLYRLEASQAARHAFRVASGLDSMVLGETQILGQLKDAVRSAEHAGALGTLLNGLFQRTFAVAKEVRSSTAVGASSVSMSAAAVKLAEQIFPSVAELNVLFVGAGEMIELVATHFAARNPSCITVANRTLERGQRLAEQFGGNAITLAELPESLARYDVVVTSTASQLPIIGKGMVERAIKARRHRPMFMLDLAVPRDVELEVGKLDDVFLYSVDDIAGIVEVGKEARQNAAEEAETIIQARVAEFTDWLKKRETVPLIRALRDEADRARRHALEGALKQLARGDAPEKVLEALSVQLTNKLMHPPTQALSSGSGAEHDAQVQAIARLYRLHPES

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Nitrosomonas eutropha (strain DSM 101675 / C91)
Length
417 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.559 kDa
Sequence
MQLFAFGVNHHTAPLDIREHVAFTEESMQHALHDLVGHQLVKEAAIISTCNRTEIYCNTDTPDKAVGWLADFHHLHSGDLEPYLYKLLREQAVKHAFRVASGLDSMVLGEAQILGQMKNAVKSAEQAGTLGLLLHKMFQHTFFVAKEVRTSTEIGACSVSMAAAAARLAERIFGNISEQKVLFIGAGEMIELCAAHFVAKRPVHVTVANRTVERAEALSRRFNAHPISLGELPDQLALHDIVVTSTASPLPILGKGMLERAIKLRKHRPIFIVDLAVPRDVEPEVAELDDVFLYYVDDLADIVREGLDSRQGAVTQAETIIDSNVMDFMHWVATRRSVPTIRALRDQAEQFRQHELSRAHKLLAKGEDPVKVLESLSSGLTNKFLHSPSSALNQVSNDEREQLVELVNRLYQLRYPR

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.245 kDa
Sequence
MIDRLAMIGVNVKTASREHVARLEKEWEKHLDTIGYASRGTVIIATCNRFEVYLDSPSRLVEDLASSIASPGGEGLVRLQGIDAARHLFRVASGLESQIIGDHEVLGQVRRAWLKSREKGFTTPLLDEVFHRALKTGARVRSESAISSGGVGYSSAAVSLAASLLGGGLDGARVGIVGAGMAAVGIARALCTRWRPRVVAVFNRTPERGWEVAGKCRGVESLVLPLDELAKLINELDALFVAIAGSTNILERGRVERGVSPRVIVDISNPPVTPKVAGRVFHMPEVEEEAKRMMEERLRWIPAAEAIIEEELEALLDALSRRRARESSRSVMRALSILAEREYERTLAGLRNGVDPREAVELALNSYTKKVGGALRRLLEEASDRGQLSLEDIEAILVSEFARIAENSGFKNGSTG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Dechloromonas aromatica (strain RCB)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.922 kDa
Sequence
MIFTLGINHHSAPLAIRERVAFGADKLPHALADLTRERPVREVAILSTCNRTEIYCSAESPDVVIDWLAHYHQVGREEIAPYIYTHDQPEAIRHAFRVASGLDSMVIGEPQILGQMKDAVRAAEENGTLGTQLHKLFQRSFSVAKEVRSTTAIGANIVSMAAAGVHLAERIFESIAGQRILFIGAGEMIELCAAHFCAGKPKQVTIANRTLERGRALAEQYGGTAIRLDELGEHLAQHDIVVSCTASPLPIIGLGMVERAIKTRRHRPIFMVDLAVPRDIEEEVGELDDVFLYTVDDLAQVVESGLESRQAAVVEAEDIIANRVKDFLGWLESRDTVPVIRSLRDSAERMRRHEIEHAMKLLAKGEAPEKVLEHLSHRLTNKFLHAPTQTLNSAEGGERADLQGAAARLFHLHAAD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thiobacillus denitrificans (strain ATCC 25259)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.872 kDa
Sequence
MQLLTLGVNHHTAPLAIREQVAFGPDKLVQALHELTLSKRASEAAILSTCNRTELYVNTVSPDALSQWFADFHHLDVRELAPYLYTLPREKAAQHAFRVAAGLDSMVLGETQILGQMKQAVAAAEEAGTLGLLLHKLFQRTFSVAKEVRSSTEIGANSVSMAAAAVRLAERIFPSVKEQACLFIGAGEMIELCMTHFAAQHPRRMTVANRTTERARPLAERFNAGVIPLTALPDEVAAYDIIITSTASPLPILGKGMLERAIRQRRHRPIFIVDLAVPRDVEAEVADMNDVFLYSVDDLGQVVREGMDNRVAQVAQAEAIIETSVASFIHWMEGRELVPVIRGLRDAAERHRRHELDKAHKALARGDDPHAVLDAMSHGLANKFLHAPTHGLSHATPEERAELVRLISQLYGLHPE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.877 kDa
Sequence
MSQIAILSVNHQLAPVEVREKVAFTPDKLTQALSDLHGIYGIYACIILSTCNRVEIYVNSDNENPKEVLSNYLAKIHNITRDRINPYLNYFEDNEALTHVCNVATGLDSLVLGEPQILGQLKNAYHMAKEAKTLNKLLEKLFQHAFSTAKKVRTDTQIGVSPVSIAYCSVKLSEKIFECLSEQTVLLIGAGEMIELCAQYLNKKKVSNMIIANRTIENAQKIANLYQAQSIGLKQFSSVIHKADIIISSTAASVPIIGKGLIESALKKRKHKPIFMLDIAIPRDIEPEVGQLDDIYLYTIDDLEQVINDNIGNREKEKNLAQEIIIKQNQVFNQWLKVLPNEQLVRSYRSNANLIKNKLLEKAIKQIKHSGDYENIIRKFADQLTNKLLHLPSKNIKQTSTDNLSQCEGCIPNIKK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Dechloromonas aromatica (strain RCB)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.922 kDa
Sequence
MIFTLGINHHSAPLAIRERVAFGADKLPHALADLTRERPVREVAILSTCNRTEIYCSAESPDVVIDWLAHYHQVGREEIAPYIYTHDQPEAIRHAFRVASGLDSMVIGEPQILGQMKDAVRAAEENGTLGTQLHKLFQRSFSVAKEVRSTTAIGANIVSMAAAGVHLAERIFESIAGQRILFIGAGEMIELCAAHFCAGKPKQVTIANRTLERGRALAEQYGGTAIRLDELGEHLAQHDIVVSCTASPLPIIGLGMVERAIKTRRHRPIFMVDLAVPRDIEEEVGELDDVFLYTVDDLAQVVESGLESRQAAVVEAEDIIANRVKDFLGWLESRDTVPVIRSLRDSAERMRRHEIEHAMKLLAKGEAPEKVLEHLSHRLTNKFLHAPTQTLNSAEGGERADLQGAAARLFHLHAAD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thiobacillus denitrificans (strain ATCC 25259)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.872 kDa
Sequence
MQLLTLGVNHHTAPLAIREQVAFGPDKLVQALHELTLSKRASEAAILSTCNRTELYVNTVSPDALSQWFADFHHLDVRELAPYLYTLPREKAAQHAFRVAAGLDSMVLGETQILGQMKQAVAAAEEAGTLGLLLHKLFQRTFSVAKEVRSSTEIGANSVSMAAAAVRLAERIFPSVKEQACLFIGAGEMIELCMTHFAAQHPRRMTVANRTTERARPLAERFNAGVIPLTALPDEVAAYDIIITSTASPLPILGKGMLERAIRQRRHRPIFIVDLAVPRDVEAEVADMNDVFLYSVDDLGQVVREGMDNRVAQVAQAEAIIETSVASFIHWMEGRELVPVIRGLRDAAERHRRHELDKAHKALARGDDPHAVLDAMSHGLANKFLHAPTHGLSHATPEERAELVRLISQLYGLHPE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.877 kDa
Sequence
MSQIAILSVNHQLAPVEVREKVAFTPDKLTQALSDLHGIYGIYACIILSTCNRVEIYVNSDNENPKEVLSNYLAKIHNITRDRINPYLNYFEDNEALTHVCNVATGLDSLVLGEPQILGQLKNAYHMAKEAKTLNKLLEKLFQHAFSTAKKVRTDTQIGVSPVSIAYCSVKLSEKIFECLSEQTVLLIGAGEMIELCAQYLNKKKVSNMIIANRTIENAQKIANLYQAQSIGLKQFSSVIHKADIIISSTAASVPIIGKGLIESALKKRKHKPIFMLDIAIPRDIEPEVGQLDDIYLYTIDDLEQVINDNIGNREKEKNLAQEIIIKQNQVFNQWLKVLPNEQLVRSYRSNANLIKNKLLEKAIKQIKHSGDYENIIRKFADQLTNKLLHLPSKNIKQTSTDNLSQCEGCIPNIKK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.51 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMRSLACTTSSNEAVIVSTCNRTELYCNNARAEEVIHWLESYHNLSHDELMPCVYHHEGQEAVRHLMRVASGLDSLVLGEPQILGQVKQSFAKAKEAGTVAVTLDRLFQSTFSVAKKVRTETEIGTAAVSVAFAAVSMAKHIFSSLASTKVLLIGAGETIELVARHLKENGVSSMVVANRTVERAQAMCEEFGATAITLSQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVGELDDAFLYTVDDLQSIIEQNMASRKEAAEQAEVIAQEQSFLFMDWIRSLESVDSIREYRTASMAIKDELVERALNKLAQGADGEQVILELANKLTNRLIHAPTQALTTASRQGDLNTLGQLRTALGLDKH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella baltica (strain OS223)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.444 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIAWLEEYHGLDHKDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTDTEIGAAAVSVAFAAVSMAKHIFSSISTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQGMCEEFGATAITLAQIPDYLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNMASRKEAAEQAEVITEEQSFLFMDWIRSLESVDSIREYRSQSMAVKDELVERALNKLAQGSDTEQVLIELANRLTNKLIHAPTQALTAASRQGDLNTLGQLRSALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella baltica (strain OS155 / ATCC BAA-1091)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.444 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIAWLEEYHGLDHKDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTDTEIGAAAVSVAFAAVSMAKHIFSSISTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQGMCEEFGATAITLAQIPDYLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNMASRKEAAEQAEVITEEQSFLFMDWIRSLESVDSIREYRSQSMAVKDELVERALNKLAQGSDTEQVLIELANRLTNKLIHAPTQALTAASRQGDLNTLGQLRSALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella baltica (strain OS185)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.467 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIAWLEEYHGLDHKDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTDTEIGAAAVSVAFAAVSMAKHIFSSISTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQGMCEEFGATAITLAQIPDYLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNMASRKEAAEQAEVITEEQSFLFMDWIRSLESVDSIREYRSQSMAVKDELVERALNKLAQGSDTEQVLIELANRLTNKLIHAPTQALTAASRQGDLNTLGQLRSALGLDKH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella baltica (strain OS195)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.444 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIAWLEEYHGLDHKDVAPCLYNYHGQDAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTDTEIGAAAVSVAFAAVSMAKHIFSSISTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQGMCEEFGATAITLAQIPDYLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNMASRKEAAEQAEVITEEQSFLFMDWIRSLESVDSIREYRSQSMAVKDELVERALNKLAQGSDTEQVLIELANRLTNKLIHAPTQALTAASRQGDLNTLGQLRSALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. tularensis (strain FSC 198)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.976 kDa
Sequence
MNMALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. holarctica (strain OSU18)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.029 kDa
Sequence
MNMALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISNLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSVFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.976 kDa
Sequence
MNMALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.356 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDSIHDAMKSLASRTRSGEAVILSTCNRTELYCNDAVATEVIEWLADYHDLNLQDLLACTYQHEDQAAVKHLMRVAAGLDSLVLGEPQILGQVKQAFVKAKEAGTTALTIDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSLKATKVLLIGAGETIELVAKHLKDNGVASIVVANRTLERAQAMCQAFDATAITLQQIPDFLPKADIVISSTASPLPILGKGMVEKALKTRRHQPMLLVDIAVPRDIEAEVGELDDAFLYTVDDLHSIIEQNMASRKEAAEQAELITEDQSLLFMEWLTSLESVDSIREYRTQSLVIKDELVERALNKLAQGGDSEQVIIELANRLTNRLIHSPTQALTVASRQGDLTTLGQLRAALGLDKH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella frigidimarina (strain NCIMB 400)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.843 kDa
Sequence
MSLVIIGINHKTATVDLREKVAFSPDRIHDAMKSLASRTRTGEAVIVSTCNRTELYCNNAEKEDIIEWLEDYHGLDHNDLMPCIYAYEEQVAVKHLMRVASGLDSLVLGEPQILGQVKQAFVKAKEAGTIALTIDRLFQNTFSVAKKVRTDTEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTIERAQAMCEEFNATAITLEQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVGELDDAFLYTVDDLHSIIEQNMASRKEAAEQAELITEDQSHIFMEWIRSLESVDSIREYRSQSLAIKDELVERALNKLSQGSDSEQVILELANRLTNRLIHSPTQALTSASRQGDLNTLGQLRSALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella halifaxensis (strain HAW-EB4)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.452 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFAPDRIHDAMKSLASCTQSGEAVIISTCNRTELYCNNSEAADVVAWLEDYHQLSHEDVEPCLYQYKGQEAVKHLMRVSAGLDSLILGEPQILGQVKQSFVKAKEAGTVAATMDRMFQNTFSVAKKIRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTQVLLVGAGETIELVARHLKDNGVKAMVVANRTISRAEAMCDEFGATAITLEQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVADLDDAFLYTVDDLQSIIEQNMASRREAAEQAELIAEDQAYQFMEWIRSLESVDSIREYRTQSMAIKDELVERAVNKLAQGGNSEQVLLELANKLTNKLIHAPTQALTAASRQGDLNSLGQLRAVLGLDKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.644 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFAPDKIHEAMKSLASRTKTGEAVIVSTCNRTELYCNTGDEADVISWLESYHQLSHDDVLPCLYKYQGQQVVQHLMRVSSGLDSLILGEPQILGQVKQSFVKAKEAGTVAVTMDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSALSATKVLLIGAGETIELVARHLKDNGVDSMIVANRTISRAEAMCEEFGATAITLEQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVADLDDAFLYTVDDLQSIIEQNMASRREAAEKAELIVEEESHHFMEWIRSLESVDSIREYRSQSMAIRDELVERAINKLAQGGDSEQLILELANKLTNKLIHAPTQALTQASRRGDLNSLGQLRAALGLDKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella oneidensis (strain MR-1)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.686 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDETDIIEWLEEYHGLEHQDVAPCLYNYHGQEAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQSMCEEFNATAITLAQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNKASRKEAAEQAELITEEQSHLFMEWVRSLESVDSIREYRSQSMAIKDELVERALNKLAQGGDTEQVLVELANRLTNRLIHAPTQALTVASRQGDLNTLGQLRTALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.425 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFGPDKIHDAMKSLAASTQSGEAVIISTCNRTELYCNNCEAADVVAWLEDYHQLSHEDVEPCLYQYKGQEAVKHLMRVSAGLDSLILGEPQILGQVKQSFVKAKEAGTVAATMDRMFQNTFSVAKKIRTETEIGAAAVSVAFAAVSMAKHIFSSISTTQVLLVGAGETIELVARHLKDNGVTTMVVANRTISRAEAMCEEFGATAITLEQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVADLDDAFLYTVDDLQSIIEQNMASRREAAEQAELIAEDQAYQFMEWIRSLESVDSIREYRTKSMAIKDELVERAVNKLAQGGNSEQVLLELANKLTNKLIHAPTQALTAASRQGDLNSLGQLRALLGLDKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.487 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIEWLEEYHGLDHKDVAPCLYNYHGQTAVKHLMRVASGLDSLILGEPQILGQVKQAFAKAKEAGTVALTIDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQGMCEEFGATAITLAQIPDYLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNMASRKEAAEQAELITEEQSYLFMDWVRSLESVDSIREYRNQSMAIKDELVERALNKLAQGGDTEQVLIELANRLTNKLIHAPTQALTAASRQGDLNTLGQLRTALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella piezotolerans (strain WP3 / JCM 13877)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.675 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFAPDRIHDAMKSLATHTQSGEAVIISTCNRTELYCNNGEEADVVQWLEDYHQLSHADVEPCLYQFKDQEAVKHLMRVSAGLDSLILGEPQILGQVKQSFVKAKEAGTVATTMDRLFQNTFSVAKKIRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTQVLLVGAGETIELVARHLKDNGVKTMVVANRTISRAEAMCDEFGATAITLEQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVADLDDAFLYTVDDLQSIIEQNMASRREAAEQAELIADDQSYQFMEWIRSLESVDSIREYRTQSMAIKDELVERAVNKLAQGGNSEQVLLELANKLTNKLIHAPTQALTAASRQGDLNSLGQLRTMLGLDKD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella sp. (strain ANA-3)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.61 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIEWLEEYHGLDHQDVAPCLYNYHGQAAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQSMCEEFNATAITLAQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNKASRKEAAEQAELITEEQSYLFMDWVRSLESVDSIREYRSQSMAIKDELVERALNKLAQGGDTEQVLIELANRLTNRLIHAPTQALTVASRQGDLNTLGQLRTALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella sediminis (strain HAW-EB3)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.581 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTKTGEAVIISTCNRTELYTNTGDEAEVIRWLEEYHQLSHEDVEPCLYKFEGQAVAQHLMRVSSGLDSLILGEPQILGQVKQSFVKAKEAGSVAITMDRLFQNTFSVAKKIRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLVGAGETIELVARHLKDNGVDSMVVANRTLSRAEGMCEEFGATAITLEQIPDYLPQADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVAELDDAFLYTVDDLQSIIEQNMASRREAAEQAEVIAEEQSHLFMEWVRSLESVDSIREYRTASMAIKDELVERAINKLAQGGDSEKLLLELANKLTNKLIHAPTQALTVASRQGDLNSIGQLRTALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella sp. (strain MR-4)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.644 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIEWLEEYHGLDHQDVAPCLYNYHGQAAVRHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRMFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQSMCEEFNATAITLAQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNKASRKEAAEQAELITEEQSHLFMEWVRSLESVDSIREYRSQSMAIKDELVERALNKLAQGGDTEQVLIELANRLTNRLIHAPTQALTVASRQGDLNTLGQLRTVLGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella sp. (strain MR-7)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.582 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIEWLEEYHGLDHQDVAPCLYNYHGQAAVKHLMRVASGLDSLILGEPQILGQVKQAFVKAKEAGTVALTIDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQSMCEEFNATAITLAQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNKASRKEAAEQAELITEEQSYLFMDWVRSLESVDSIREYRSQSMAIKDELVERALNKLAQGGDTEQVLIELANRLTNRLIHAPTQALTVASRQGDLNTLGQLRTALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella sp. (strain W3-18-1)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.487 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLASRTRSGEAVIVSTCNRTELYCNNGDEADIIEWLEEYHGLDHKDVAPCLYNYHGQTAVKHLMRVASGLDSLILGEPQILGQVKQAFAKAKEAGTVALTIDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSLSTTKVLLIGAGETIELVAKHLKDNGVASMVVANRTLERAQGMCEEFGATAITLAQIPDYLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEPEVADLDDAFLYTVDDLHSIIEQNMASRKEAAEQAELITEEQSYLFMDWVRSLESVDSIREYRNQSMAIKDELVERALNKLAQGGDTEQVLIELANRLTNKLIHAPTQALTAASRQGDLNTLGQLRTALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Shewanella woodyi (strain ATCC 51908 / MS32)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.574 kDa
Sequence
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMKSLAKCTKTGEAVIISTCNRTELYTNTGDEAEVIRWFEEYHQLSHEEVEPCLYKFEGQGVVKHLMRVSSGLDSLILGEPQILGQVKQSFAKAREAGSVAITMDRLFQNTFSVAKKVRTETEIGAAAVSVAFAAVSMAKHIFSSISSTKVLLIGAGETIELVARHLKDNGVDSMVVANRTLSRAEGMCDEFGATAITLEQIPDFLPKADIVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVADLDDAFLYTVDDLQSIIEQNMASRREAAEQAEVIAENESHLFMEWVRSLESVDSIREYRTQSMAIKDELVERAINKLAQGGDSEQLLLELANKLTNKLIHAPTQALTAASRQGDLNSIGQLRSALGLDKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Ruthia magnifica subsp. Calyptogena magnifica
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.617 kDa
Sequence
MSQIAILSVNHQLVPVEVREKVAFTPDKLIQALNNLHHIDGIDACIILSTCNRVEIYVASNHKNSEELLSNYLAKTHNIKRDIIDSYLNYFEGNEALTHLCNVATGLDSLVLGEPQILGQLKNAYHIAKEVKTLNKLLEKLFQHTFSTAKKVRTNTQIGASPVSIAYCAVKLSEKIFEQLSEQTVLLIGAGEMIELCAHYLNQKGVNKMIVANRTIENAKKIAHLYQAQSIGLKQFSSFVYKADIIISSTAASMPIIGKGLIESALKKRKHKPIFMLDIAIPRDIEPEVGQLDDVYLYTIDDLGQVVNDNIGNREKEKGLAQEIIVKQNQVFNKWLDTIPNEQMVQSYQFGANSIKNELLEKAIKQLKNGANSEDTIRKLADQLANKLLHLPFKNIKQTSIENLSQCEGCIPYIKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Length
416 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.558 kDa
Sequence
MQLFAFGVNHHTAPLDIREHVAFSEESMQHALHDLVGHQLVKEAAIVSTCNRTEIYCNTDTPDKAVGWLADFHHLRFGDLEPYLYRLLREQAVKHAFRVASGLDSMVLGEPQILGQMKNAVKSAEQAGTLGLLLHKMFQRTFFVAKEVRTSTEIGACSVSMAAASARLAERIFGNISEQKVLFIGAGEMIELCAAHFVARHPVHVTVANRTVERAEALARRFNAHPISLGELPDQLALHDIVVTSTASPLPILGKGMLERAIKQRKHRPVFIVDLAVPRDVEAEVAELDDVFLYYVDDLADIVKEGLDNRQGAVTQAETIIESNVVDFMHWVATRQSVPTIRALRNQAERYRRHELARAHKLLAKGEDPEKVLESLSSGLTNKFLHLPSSVLNHATDDEREQLIELVNRLYQLHHS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.453 kDa
Sequence
MQLTAVGLNHQTAPLSIREKLAFAAAALPEAVRNLARSNAATEAVILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEIRPYLYTLDMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRAAQEQESMGAKLNALFQKTFSVAKEVRTDTAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKNPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHDYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIKALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSVQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Neisseria gonorrhoeae (strain NCCP11945)
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.453 kDa
Sequence
MQLTAVGLNHQTAPLSIREKLAFAAAALPEAVRNLARSNAATEAVILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEIRPYLYTLDMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRAAQEQESMGAKLNALFQKTFSVAKEVRTDTAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKNPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHDYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIKALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSVQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Neisseria meningitidis serogroup C (strain 053442)
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.486 kDa
Sequence
MQLTAVGLNHQTAPLSIREKLAFAAACLPEAVRNLARSNAATEAVILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTFSVAKEIRTDTAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKSPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHEYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIRALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSIQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.472 kDa
Sequence
MQLTAVGLNHQTAPLSIREKLAFAAACLPEAVRNLARSNAATEAVILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTFSVAKEVRTDTAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKSPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHEYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIRALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSIQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Neisseria meningitidis serogroup B (strain MC58)
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.48 kDa
Sequence
MQLTAVGLNHQTAPLSIREKLAFAAAALPKAVRNLARSNAATEAVILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEIRPYLYALDMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTFSVAKEVRTDTAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKSPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHDYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIKALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSVQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Neisseria meningitidis serogroup C
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.472 kDa
Sequence
MQLTAVGLNHQTAPLSIREKLAFAAACLPEAVRNLARSNAATEAVILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTFSVAKEVRTDTAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKSPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHEYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIRALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSIQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.472 kDa
Sequence
MQLTAVGLNHQTAPLSIREKLAFAAACLPEAVRNLARSNAATEAVILSTCNRTELYCVGDSEEIIRWLADYHSLPIEEISPYLYTLGMQETVRHAFRVACGLDSMVLGEPQILGQIKDAVRVAQEQESMGKKLNALFQKTFSVAKEVRTDTAVGENSVSMASASVKLAEQIFPDIGDLNVLFIGAGEMIELVATYFAAKSPRLMTVANRTLARAQELCDKLGVNAEPCLLSDLPAILHEYDVVVSSTASQLPIVGKGMVERALKQRQSMPLFMLDLAVPRDIEAEVGDLNDAYLYTVDDMVNIVQSGKEARQKAAAAAETLVSEKVAEFVRQQQGRQSVPLIRALRDEGEKARKQVLENAMKQLAKGATAEEVLERLSIQLTNKLLHSPTQTLNKAGEEDKDLVHAVAQIYHLDK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Teredinibacter turnerae (strain ATCC 39867 / T7901)
Length
415 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.46 kDa
Sequence
MTLLALGINHNTATLDVREKVAFSPAELEVALCALRESGLAEEVAILSTCNRTEIYCETGAEAQHLLVWLAEHKAASAQELQHAHYARWGDDAARHMMAVASGLDSLVLGEPQILGQMKSCYAVAREAGVLGRGLHDAFQRVFAVAKRVRSETAIGENPVSVAYAAVSLAQQIFSDLKQDTALLIGAGETIELVARHLKNQGIKKLIVANRTLENAHALAKEFAAEAILLADIPEYLPTADIVISSTASQLPLLGKGAVEVALKKRKHKPMFMVDIAVPRDIEPQVGDLADVYLFTVDDLKEVIDENKKSREEAAKTARTIIDEGVERYQLDQRALSAVELVKDFRQQTEAVRDQEVQKALNALRSGADPEELLLTLSRNLTNKFMHQPTTALKRASSEGREQLLQDFKSLFGLD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.528 kDa
Sequence
MVDNIIDTDNYYAIVYTYKTIGLSKLYEHYIPEKDLINIRFSDTQVSLLQTCNRVELYLYTKDRNKINDILSKLNETHGKDISSNAIVLRGKDAINHLYQVASGLDSLAIGEYEILGQIKEALTSCKKHSLCNEEIELLFNAAIKVGRKVRSLTNISKGKVGIYSIAIQKSLEVMGDLTDIKIAIVGAGEIGSKLAFMLKNNGARNLTIFNRNLDRALELSNKFGYNAELLDFQKVNEYDLVFIAINNSNPSQLRLDKPKLVIDLSVPPVVYKTSNVIYLDDLRVISDNIILNKREDIKKAEAIINEEIQKFESLLNNYNMNRLVSRFMSEIEWVREKEVDRAFNEILKNYADKDNIKEIIDKMTYSLIKKVFSPILEDLRKDPNNKKQIVEYLIEVFQNGQFSDTKTQKIEKQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.982 kDa
Sequence
MQLVVVGAHQRTAPISIRERIAFAEAELAQALSSLRQIAVEGFILSTCNRVELYALVEEADGGRSLRQFLAQQRSIDLDELMPHVYTYLDEDAVRHLFRVASGLDSMALGEAQILSQIKTAYNAAQQTELLGTTMHRLIQAALTTGKLVRTETQLAHAQLSVVSVGLSLARQHLDLTNRSVVIIGAGRTGELALKHYLEYTSNITVLSRTFERAARLAEHHKVAAKPISELAAVLQASDVVISCTSSPELMLDFEQAQLLQAQRQRQWVLLDLAVPRDIDRHVGALPEVWLYDVDDMQAICERNRASKAAEVAGAEAIVERELIKWQEWWLTQAVLPTIRALRAHAEAIRLAELERTLARLDLSEQQQQAVSALTSAIINKLLHQPMRAIKDTAASPQLAHAAQQLFRLDFEAI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella philomiragia subsp. philomiragia (strain ATCC 25017)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.658 kDa
Sequence
MALISLAIDYKKSPIEVRSEFALSGLDVSMLYKSILAIDNVVHAVILSTCNRTEVYLEITDLRVVDDILAWWQSYVRNPEFKIRDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKKVRSETRIGHCPVSVAFSAITLAKKQLDNISTKNVLIIGAGQTGELLFRHVTALNPKHIMLANRTIEKAEKITSTFNNASAYYLSDLPKLIKKADIIIAAVNVTEYIVKCEDVGEKSRVFIDISIPQALDPKLGDLEQNAYYCVDDINTVIEGNKDKRKHESSRAQKIIVKSLEDYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDPEEVLKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.742 kDa
Sequence
MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLIVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSVFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. holarctica (strain LVS)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.785 kDa
Sequence
MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSVFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. mediasiatica (strain FSC147)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.731 kDa
Sequence
MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. novicida (strain U112)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.699 kDa
Sequence
MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGYCPVSVAFSAITLAKRQLDNICSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLIKKADIIIAAVNVSEYIVTCKDVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Francisella tularensis subsp. tularensis (strain WY96-3418)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.731 kDa
Sequence
MALISLAIDYKKSPIEVRSEFALSGLDVSMLYRSILAIDNVVHAVILSTCNRTEVYLEISDLRVVDDILVWWQGYVRNPNYKIKDYFKLRQGTEVIMHLMKLACGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRVFQKVFATAKRVRSETRIGHCPVSVAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPKQIMLANRTIEKAQKITSAFRNASAHYLSELPQLIKKADIIIAAVNVLEYIVTCKYVGDKPRVFIDISIPQALDPKLGELEQNVYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAIISNSAIKELFQKADGLVDLSLEKSLAKIRNGKDAEEIIKRFAYEIKKKVLHYPVVGMKEASKQGRSDCLVCMKRMFGLNVEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)
Length
414 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.81 kDa
Sequence
MHLFTVGVNHTTAPVSIRENVAFQNEHLSGALRDLNSHGIREAAILSTCNRTELYCNTDDPQKALEWLANYHRLKPQAIAPYMYTLPQENAVKHAFRVASGLDSMVLGEAQILGQMKQAVRIAENAGTLGTLLHKLFQRTFSVAKEVRTNTNIGANSVSLAAASTRLAQRIFGALNNQHVLFIGAGEMIELCAEHFAAHRPLSLTVANRTLERGQELAASIGGTSMLLADLPDRLAEFDIVITSTASQLPIVGLGMVERAIRARKHKPMFMVDLAVPRDIEPEAGELDDVFLYTVDDLAQIVQEGMENRQEAAAEAEAIIDMRVENFMQWLKTRSAVPTIRALREQAERHRLNELEKARKLLARGHDPAQVLDALSNALTNKLLHGPSHALNSATGEDREQLEATLRQLYQIHH

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rickettsia bellii (strain RML369-C)
Length
414 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
45.964 kDa
Sequence
MSYYDTIFSDHIDKIKSEGRYREFKALKRQADNFPFAMCDDKQIVMWCINDYLGMSKHPKVVQASIDAVLKYGVGSGGTRNIGGNNVAILELEQELASLHNKEASLVFTSGFVANDTTLATLAKIMPNIVFFSDELNHASIIAGITGSKAEKHIYRHLDVKHLEELLQSVDINRPKIIVFESAYSMDGFFSPVKDIINLAKKYNALTFIDEVHTVGLYGKTGAGIAELLDCSDEIDIIQGTLAKAYGTIGGYITANHSLIDAIRLSASGFIFTTSLPPVISTAATHSIRHLKESNQERKTHQQVVSKLKSSFDRFNIPYLKNESHIVPIIIGDPIKASKASNMLLNEYSIYVQHINFPTVPRGTERLRIIPTPAHTDEMINDLSIALVQIFAALNIELSSTKELNDEIYLNLIA

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Length
414 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
46.238 kDa
Sequence
MSYYDIIFSKHIDKIKSEGRYREFKALKRQADNFPFAEHANKQIVMWCINDYLGMSKHAKVMHASIDALLKYGVGSGGTRNIGGNNIAILELEKELANLHKKQAALVFTSGFVANDTTLASLAKIMPDIVFFSDELNHASIIAGITSSRAEKYIYRHLDVKHLEELLQSVDINRPKIVVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVGLYGKQGGGIAELLNCSDQIDIIQGTLAKAYGTIGGYITSNHNLVDAIRLTAPGFIFTTSLPPVISTAATHSIRHLKESNEERIKHQEVVTKLKNSFERFNIPYLKNESHIVPIIIGDPIKTAKASNMLLNEYGIYVQHINFPTVPRGTERLRIIPTPAHTDKMINDLSVALVQIFAELDIELSSAKELNEEVRLNLIA

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Length
414 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
46.18 kDa
Sequence
MSYYDTIFSKHIDKIKSEGRYREFKALKRQADNFPFAEHANKQIVMWCINDYLGMSKHAKVMQASIDALLKYGVGSGGTRNIGGNNIAILELEKELADLHKKQAALVFTSGFVANDTTLASLAKIMPDIVFFSDELNHASIIAGVTSSRAEKYIYRHLDVKHLEELLQSVDINRPKIIVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVGLYGKHGGGIAELLNCSDQIDIIQGTLAKAYGTIGGYITSNHNLVDAIRLTAPGFIFTTSLPPVISTAATHSIRHLKESNEERIKHQEVVTKLKNSFENFNIPYLKNESHIVPIIIGDPIKAASASNMLLNKYGIYVQHINFPTVPRGTERLRIIPTPAHTDKMINDLSIALVHIFAELDIELSSTKELNEEIRLNLIA

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rickettsia prowazekii (strain Madrid E)
Length
414 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
46.516 kDa
Sequence
MSYYDTIFNKHIDKIKSEGRYREFKSLKRQADNFPFAEYEDKQIVMWCINDYLGMSKHVKVMQASIDALLKYGVGSGGTRNIGGNNISILELEKELADLHSKETALVFTSGFVANDTTLASLAKIIPDIVFFSDELNHASIIAGIKSSRAEKYVYRHLDVQHLEKLLQSVDINKPKIIVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVGLYGKQGGGISELLDCSNQIDIIQGTLAKAYGTIGGYITSNYNLIDAIRLTAPGFIFTTSLPPVISTAATHSIRHLKESNEERIKHQEVVTKLKNSFEHFNIPYLKNESHIIPIIIGDPIKATKVSNMLLNEYGIYVQHINFPTVPRGTERLRIIPTPAHTDKMINDLSTALVHIFDELDIELSSAKELNKEVRLHLIA

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Length
414 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
46.46 kDa
Sequence
MSYYDTIFNKHIDKIKSEGRYREFKSLKRQADNFPFAEYEDKQIVMWCINDYLGMSKHIKVMQASIDALLEYGVGSGGTRNIGGNNISILELEKELADLHSKETALVFTSGFVANDTTLASLAKIIPDIVFFSDELNHASIIAGITSSRAEKYVYRHLDVQHLEKLLQSVDINKPKIIVFESAYSMDGFFSPIKDIINLAKKYNALTFIDEVHTVGLYGKQGGGISELLDCSNQIDIIQGTLAKAYGTIGGYITSNYNLIDAIRLTAPGFIFTTSLPPVISTAATHSIRHLKVSNEERIKHQEVVTKLKNSFEHFNIPYLKNESHIIPIIIGDPIKATKVSNMLLNEYGIYVQHINFPTVPRGTERLRIIPTPAHTDKMINDLSTALVHIFAELDIELSSTKELNKEVRLHLIA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Coxiella burnetii (strain Dugway 5J108-111)
Length
413 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.586 kDa
Sequence
MPLLVCGINHQSAPLTVREKLVFTPERTPLALQSLLAEKAVNEALLLSTCNRTEIYTTVDEAATILRWLSKQPQLSGIDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVFAATKRIRSETAIGANPVSIAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGARHFFIANRTLTRAKQIAEPYHAQAIRLSDIPTYLPKVDIVISATMSQLPLVGKGAVESALRQRKRRPLFMADLALPRDIEPETAQLEDVYLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVHKAGDTIRRFRERVEMLRDQELEKALAHFQRTNDPKAVIAHFAHNLTNKILHQPTTKLRQAAYEDQVQLLLSAKELFDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Coxiella burnetii (strain RSA 331 / Henzerling II)
Length
413 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.586 kDa
Sequence
MPLLVCGINHQSAPLTVREKLVFTPERTPLALQSLLAEKAVNEALLLSTCNRTEIYTTVDEAATILRWLSKQPQLSGIDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVFAATKRIRSETAIGANPVSIAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGARHFFIANRTLTRAKQIAEPYHAQAIRLSDIPTYLPKVDIVISATMSQLPLVGKGAVESALRQRKRRPLFMADLALPRDIEPETAQLEDVYLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVHKAGDTIRRFRERVEMLRDQELEKALAHFQRTNDPKAVIAHFAHNLTNKILHQPTTKLRQAAYEDQVQLLLSAKELFDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Length
413 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.586 kDa
Sequence
MPLLVCGINHQSAPLTVREKLVFTPERTPLALQSLLAEKAVNEALLLSTCNRTEIYTTVDEAATILRWLSKQPQLSGIDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVFAATKRIRSETAIGANPVSIAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGARHFFIANRTLTRAKQIAEPYHAQAIRLSDIPTYLPKVDIVISATMSQLPLVGKGAVESALRQRKRRPLFMADLALPRDIEPETAQLEDVYLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVHKAGDTIRRFRERVEMLRDQELEKALAHFQRTNDPKAVIAHFAHNLTNKILHQPTTKLRQAAYEDQVQLLLSAKELFDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Coxiella burnetii (strain Dugway 5J108-111)
Length
413 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.586 kDa
Sequence
MPLLVCGINHQSAPLTVREKLVFTPERTPLALQSLLAEKAVNEALLLSTCNRTEIYTTVDEAATILRWLSKQPQLSGIDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVFAATKRIRSETAIGANPVSIAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGARHFFIANRTLTRAKQIAEPYHAQAIRLSDIPTYLPKVDIVISATMSQLPLVGKGAVESALRQRKRRPLFMADLALPRDIEPETAQLEDVYLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVHKAGDTIRRFRERVEMLRDQELEKALAHFQRTNDPKAVIAHFAHNLTNKILHQPTTKLRQAAYEDQVQLLLSAKELFDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Coxiella burnetii (strain RSA 331 / Henzerling II)
Length
413 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.586 kDa
Sequence
MPLLVCGINHQSAPLTVREKLVFTPERTPLALQSLLAEKAVNEALLLSTCNRTEIYTTVDEAATILRWLSKQPQLSGIDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVFAATKRIRSETAIGANPVSIAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGARHFFIANRTLTRAKQIAEPYHAQAIRLSDIPTYLPKVDIVISATMSQLPLVGKGAVESALRQRKRRPLFMADLALPRDIEPETAQLEDVYLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVHKAGDTIRRFRERVEMLRDQELEKALAHFQRTNDPKAVIAHFAHNLTNKILHQPTTKLRQAAYEDQVQLLLSAKELFDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Length
413 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.586 kDa
Sequence
MPLLVCGINHQSAPLTVREKLVFTPERTPLALQSLLAEKAVNEALLLSTCNRTEIYTTVDEAATILRWLSKQPQLSGIDLRSFCYARRDIEMVRHVMRVGSGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRLFPAVFAATKRIRSETAIGANPVSIAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGARHFFIANRTLTRAKQIAEPYHAQAIRLSDIPTYLPKVDIVISATMSQLPLVGKGAVESALRQRKRRPLFMADLALPRDIEPETAQLEDVYLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVHKAGDTIRRFRERVEMLRDQELEKALAHFQRTNDPKAVIAHFAHNLTNKILHQPTTKLRQAAYEDQVQLLLSAKELFDL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)
Length
413 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.514 kDa
Sequence
MENNTIPKHNTFYAIGLNYKKADAEIRGKFSIDAQSKSNLLQQAKTEGIESLIVTSTCNRTEIYGFAQHPFQLIKLLCENSKGTVEDFQKVAYVYKNQEAISHLFKVGTGLDSQILGDFEIISQIKIAFTESKALDLANSFMERLVNSVIQASKRIKTDTDISSGATSVSFASVQYIMKNVANIGEKNILLFGTGKIGRNTCENLVKHSKNEHITLINRTKDKAEKLAGKLNLIVKDYADLHIELQKADVLVVATGAQNPTIDKAILNLKKPLLILDLSIPKNVNSDVNELENVTLVHLDDLSQITDETLEKRKLHIPAAEAIIEEIKNEFSSWMNGRKYAPTIHALKAKLNTIKEKELIFQRKKLSNFDEEQAELISNRIIQKITNHFANHLKDEETMVDESIDYINKIFQL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Length
412 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.333 kDa
Sequence
MSDEFIDINNYIAIVYTYKTVGISKLYEHYVKDQELLLLKGLIKGEISVLQTCNRAETYLYTYNKEEFKDFLQKLDEIHGKQISKDAMILKGEDAVKHLFEVASGLDSLAIGEYEILRQLKESIEKSKKLGLSSEKLEFLFKNAIKVGRKIRQQTEISKGKTGIYALAVEYAKHVSNNNIGNVKIAIVGAGEIGNKLALMLKNEGAQNVTIFNRTYEKALEVANKYGFKAEPLDFYKINNYDIVFVAIYYDKKINLPNPKLVIDLSVPQIVLGNNVITLENLRSISDKIMETKILSLQKAEELIHIEIENFKNEIIKYNQNRLISKFMKRIEDIREAEINRAYAEILKHANDKEEIKNIIDKMTNSMLKKIFSPLFETVRKNEDMANYINNIFEILSNGNISNSKTEEAKEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Length
411 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.007 kDa
Sequence
MPRLLEELTAVILTHRDAPLDVVGSFESRVGEAYQILRGVVDEAVVLATCNRFEVYALPRRGFVETVIGFLGEASRYARILHGMDVVRHLFRVAAGLESAIIGENEILGQVARAYEEARRRGVAGKYLGLLFSQAVRTGKLVRSRTRISYGNVGAPGAAVKLAREAAGGFDGKHVVVVGAGEAGSIMASLVREEAPTARISIVNRSVDRARELAGKVRGEAYGLDMLPKLLAAADVVLVAVTVNEPVIKRSMLEDVGRHLVVVDISNPPAVEQPIPSNVYYAGLRDVEKVIKEVLAVRIREVPKAEAIVEEQVALLRKLWLKRGADEAIAEIMRYANRVMEEEVEELVSRLRGLGVDGAALLVARSFAYSLTKKLLRPLILYAHEAALEGSLSKLEEIAQKYRDELARRQH

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium novyi (strain NT)
Length
411 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.552 kDa
Sequence
MNLAVIGINYNNTPIDIREKVSFSKSQKYKACTYLIKKGISEIIIVSTCNRSEIYICSDEIDSHINEVVNFYKIFFNVESVNEYIFIKKDKEAVSHIYNVSAGLDSMILGEDQILGQVKEALRYSMENKFSRKVLNKLFREAITSAKKIKSELKISETPISMVYIAIKLLEKNIGTLKGKKACIIGAGDMGRLALKHLINEELEEIFVANRTYNNVIDLLKEFPKIKLIDYEKKYEILDNVDILITATAAPHLIIKKEQLQNIKQELYIMDLALPRDVEKSAGDIENIHLYDVDDFKNISDSNKIKREELSLIAKDSIDSYVNEFNQWMKSLKVDNTIKDLNNRCRDIKDEYLGYITKKIDLNERDKEILEKMLFGALKKVVKEPILNLKELKDEDEINKYIKSVNELFKF

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Length
409 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.691 kDa
Sequence
MLMNIVTLISWDFKRNNESFQRAIINGYDYWSRILDDHGVEKYVILLTCNRVELYYRGDPFDVQEKGYNIISDDMAINHLFHVAAGLDSMSIGENEVLKQVKQAYEKSSSMGKSDKFLSLIFQRAISVGKLVRSKTGIGKGKVSIPSIVYDIVRKNGGNKILLVGNGMLASEIAPYFSYPQYKVTVAGRNIDHVRAFAEKYEYEYVLINDIDSLIKNNDVIITATSSKTPIVEERSLMPGKLFIDLGNPPNIERGNNVITLDEIYEISKKNEMLREEKINQAEILIENEMKATMNKIKDLMIDDIFSQFYRFASVVQTMEIQKFRKMHPEVNENDLEALAHSIINKILNVPVTTLKAVSRSQGNSDFNRLFESFSSNFNDIVSAALQSYEGLRDTQSLRDRTRQLLQKS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Length
409 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.691 kDa
Sequence
MLMNIVTLISWDFKRNNESFQRAIINGYDYWSRILDDHGVEKYVILLTCNRVELYYRGDPFDVQEKGYNIISDDMAINHLFHVAAGLDSMSIGENEVLKQVKQAYEKSSSMGKSDKFLSLIFQRAISVGKLVRSKTGIGKGKVSIPSIVYDIVRKNGGNKILLVGNGMLASEIAPYFSYPQYKVTVAGRNIDHVRAFAEKYEYEYVLINDIDSLIKNNDVIITATSSKTPIVEERSLMPGKLFIDLGNPPNIERGNNVITLDEIYEISKKNEMLREEKINQAEILIENEMKATMNKIKDLMIDDIFSQFYRFASVVQTMEIQKFRKMHPEVNENDLEALAHSIINKILNVPVTTLKAVSRSQGNSDFNRLFESFSSNFNDIVSAALQSYEGLRDTQSLRDRTRQLLQKS

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Length
409 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
44.374 kDa
Sequence
MDYNLALDKAIQKLHDEGRYRTFIDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIADLHGKEAALVFSSAYIANDATLSTLRVLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIADEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASAKMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCALNRAEASA

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Length
409 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
44.574 kDa
Sequence
MDYSQFFNSALDRLHTERRYRVFADLERMAGRFPHAIWHSPKGKRDVVIWCSNDYLGMGQHPKVVGAMVETATRVGTGAGGTRNIAGTHHPLVQLEAELADLHGKEAALLFTSGYVSNQTGIATIAKLIPNCLILSDELNHNSMIEGIRQSGCERQVFRHNDLADLEALLKAAGANRPKLIACESLYSMDGDVAPLAKICDLAEKYNAMTYVDEVHAVGMYGPRGGGIAERDGVMHRIDILEGTLAKAFGCLGGYIAANGQIIDAVRSYAPGFIFTTALPPAICSAATAAIKHLKTSSWERERHQDRAARVKAILNAAGLPVMSSDTHIVPLFIGDAEKCKQASDLLLEEHGIYIQPINYPTVAKGSERLRITPSPYHDDGLIDQLAEALLQVWDRLGLPLKQKSLAAE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Length
409 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.682 kDa
Sequence
MQILTLISWDFKRNNNFFNQAVLNPYEYWADILEKNGISRYVILLTCNRVEIYLRAGFPEDLEAMKPNVLHDEEAIKHLMEVSSGLDSMSLGENEILKQVKEAYELSVRNGKVDKVLSLIFQKAIFVGKKVRSETEISRGKVSVPSIVYDILSSRVVQKVLIIGNGMIAGEIAPYLSGKFEVTIAGRNIDHVKDLASKYNYSYTTINDLHELIMRNDAIISATSSKTPIIRREEMVEGKLYIDLGNPRNIEDKPGADIITIDDIYSVSNRNGSARMESVDEARRIIEIEMASLMNKIKDVMIDEIFADFYKFAVVVQKMEIEKFSRMHPEIPASDVEAFAHSMINKVMNIPVMTLKSVARSQSNQDFSRIFSKFYDNFSDLVSAALQSYEGRQDTQSLRDRTRRLLQRS

Gene
hemA
Protein
5-aminolevulinate synthase 1
Organism
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Length
407 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
44.616 kDa
Sequence
MDYNLALDTALNRLHTEGRYRTFIDIERRKGAFPKAMWRKPDGSEKEITVWCGNDYLGMGQHPVVLGAMHEALDSTGAGSGGTRNISGTTLYHKRLEAELADLHGKEAALVFSSAYIANDATLSTLPQLIPGLVIVSDKLNHASMIEGIRRSGTEKHIFKHNDLDDLRRILTSIGKDRPILVAFESVYSMDGDFGRIEEICDIADEFGALKYIDEVHAVGMYGPRGGGVAERDGLMDRIDIINGTLGKAYGVFGGYIAASSKMCDAVRSYAPGFIFSTSLPPVVAAGAAASVRHLKGDVELREKHQTQARILKMRLKGLGLPIIDHGSHIVPVHVGDPVHCKMISDMLLEHFGIYVQPINFPTVPRGTERLRFTPSPVHDSGMIDHLVKAMDVLWQHCALNRAEVVA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167)
Length
406 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.009 kDa
Sequence
MGIDDYLSKIRALTLNHKRVSTITLSETYFNRDEVYGKLMNYYDEVFLLQTCNRVEVYVYGDDDSVAEDMYKVKGTINHVDKLVGMNAVRHIFRVAAGLESAAVGESEILGQVEDAFNDARKRGALGGLLGFTIERAIRTGKEIRSRFPEISIGLASIGSLVAEYVHRVRGLNSRIAVIGAGSIGSDIVRRLAEKGFRNVIIVNRTLDKAKAAALRYGFNYAPIDSLRSVIRDSDVVIFATSATNPLLRRRDAEELSGKPIIIDVGVPRNVDPEIPGVVSIDELKNIENEIREGKRKALDEASRLIELRLIEYRRLFARRVIEGMIGELTKWGLSIGESEVKRAVKAGLIKNEEDGAALAVKSTVKKIMLPLLTYLKELAEEDKFDEALIIISGIKAKLNGDGKQS

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Aquifex aeolicus (strain VF5)
Length
406 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.648 kDa
Sequence
MGEIFVAGVNFKVAPVEVREKLACSLEETKKVLPILKRETPLEEVMLLSTCNRVEVYAYNFVENSEDLINKLLEIKRLNPSFKRYFFVKRGEEAVYHIFKVASSLDSMVIGEPQIVAQFKEAYRVAKEAGTVGKILNRVYEKALRASKRVRTETGISRSAVSVSYAAVELAKKIFGDLKEAKVLLIGAGEMGELAANYLRRFGAKLHITNRTYERALKLVKELSGNVLRFEELKEYLPLMDIVIVSTGAKDYILKREDFERSVRERHYEPQFVIDIAVPRNVDPEAGNVEGVFLYDIDDLKQVVEENLKERIKEAQRGEIILWDEVKKFMNWYESLKAEPYILELKASVEGKEVSPYIKKLVHRAIKEIKRNPEVADIILRIFKEVEKNEPRRKELSNVYNGTHGA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
Length
406 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.246 kDa
Sequence
MTMTLSVVAVTHRTAPVTIRERLSLPVEQQCQWLQRWGNQVPEIVLLVTCHRTEVYWLDGEETAHRGVEWLAELGGLTVEELERWVLQRSGAEAVRHAFCVAAGLDSRVVGEPQILGQVRRARDLARAAGTLGPILDRLFSCSLATGRMVRVRAGWSTGKRSLARVAVREAARLCSDLQSARVLVLGAGETGRDVIAALCRCQPAVVWWTNRSPGRLAQIPSEEPVRIVDWSEWPRLVTEADVVFVATNAPEPIVRLEHVTRHARLPRLLVDLAVPRNVDPAISDVPGIRVVTIDDLPADPVPVAAWDGVAVEPYVERAVQRYLRWLEARSIAAEIRAAHETLQSMLERELEKVLRLALRDPARTGEVKRVAAASMARKTLFPLFRALESEPQRVALALRLLAYDR

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rhizobium radiobacter
Length
405 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
44.412 kDa
Sequence
MDFEAFFTTELQSLHSEGRYRVFADIERQQGNFPRATRYNANGQRKDVTVWCSNDYLGMGQNPKVIEAMKAAIDHCGAGAGGTRNISGTNHYHVLLEQELADLHGKESALIFTSGYVSNWATLGTLGQKIPGLIIFSDALNHASMIEGIRYGRCERVIWKHNDLEDLEAKLKAADPNAPKLIAFESVYSMDGDIAPIKEICDLADRYGAMTYLDEVHAVGMYGPRGGGIAEREGLMDRLTIIEGTLGKAFGVMGGYITGSTAVCDFIRSFASGFIFTTALPPSLAAGAIASIQHLKASPFERARHQDRVRKLRGLLDARGIPHMDNPSHIVPVMVGDAAKCKWISDILLDSHGVYVQPINYPTVPRKTERLRITPTPLHSDADIEHLVGALHQLWSHCALARAVA

Gene
hemA
Protein
5-aminolevulinate synthase
Organism
Rhizobium meliloti (strain 1021)
Length
404 amino acids
Similarity
Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Mass
44.116 kDa
Sequence
MDFESFFKNELDGLHQEGRYRVFADLARHRGSFPKATRYTADGAQEVTVWCSNDYLGMGQCPIVTEAMKNAIDECGAGAGGTRNISGTNHYHVLLERELADLHGKESALLFTSGYVSNWAALGTLCSKIPGVIVFSDAGNHASMIEGIRHSKCERVIFKHNSVADLEAKLAAADPRAPKIIAFESVYSMDGDIAPIREFCDLADKYGAMTYLDEVHAVGMYGPRGGGIAEREGLMHRLTVIEGTLGKAFGVMGGYITGSAALCDFIRSFASGFIFTTALPPALAAGALASIRHLKESQVERFAHQERVRRLRSLLDQRGIPHMVNPSHIVPVIVGDAAKCKWISDLLLDNFGIYVQPINYPTVPKKTERLRITPTPMHSDADIDHLVSALHSLWSRCALARAVA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Length
404 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA). In the absence of NADPH, exhibits substrate esterase activity, leading to the release of glutamate from tRNA.
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.444 kDa
Sequence
MEDLVCVGITHKEAEVEELEKARFESDEAVRDIVESFGLSGCVLLQTCNRVEVYASGARDRAEELGDLIHDDAWVKRGSEAVRHLFRVACGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKIVFRRAINLGKRAREETRISEGAVSIGSAAVELAERELGSLHDKTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGGEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVREALRKRDRRSPILIIDIANPRDVEEGVENIEDVEVRTIDDLRVIARENLERRRKEIPKVEKLIEEELSTVEEELEKLKERRLVADVAKSLHEIKDRELERALRRLKTGDPENVLQDFAEAYTKRLINVLTSAIMELPDEYRRAACRALRRASELNG

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Length
402 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
44.941 kDa
Sequence
MLQVILNIRLDHKTSDVKTMESSHERMEAIVAELESSGTVMEKVPIRTCNRIEYYLSVQEIPPGFEFDGFTVEGDEDALRHILRLASGLESMIIGEDQILGQIKAARVQALREGTCGPVLDMVFTKAVHVGQTVRRKTQINRGSVSIGSAAVDLAESIHGDLKCRKVLAIGAGKMGTLVARALAEKHLSAIMVANRTYERAYQLACELGGDAIHFDRLNRALRDADVVISATGSPHYILTRERVRDAIPPERRSAVVMVDIANPRDIEESVRELGIRLFTIDDLRGVAEENRRRREAEAREAERIVEGELKLLLRSLKHMEVEPLLAEVRGNMESLRRREAERALNKIMNSSDPEGVIEALSRSIVDKIFHDIAISIRQAAERGDEEFLSMCAKLFNCKDLK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828)
Length
401 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.302 kDa
Sequence
MIIMIPIYAITWNFRDTPEGFDKIVNNDYNYFESLCKKSSIDEFVILITCNRVEIYAYTRNEIDKDLFKDSLIYNYPESTMHLLRVASGLESMSIGENDIMRQVKEAYELSIKRKTSGKILSYIFKKALNVGKEVRTQTSISRGKTSIPAISLDICDNEYGINNKSILIIGNGKMATDFSRYLKEYRPGNVTIAGRSIDHARNLAVLYGYSYDSIKNLNNLIKNSDIIIAATSAGNYIVKDLGDLARNKYFIDISKPENIDPEISKYARLLSINEIGKILKRNEDEKKGEVEIAEVIINQEQKTIDEKLKEMMLDDVIAMFYKFANNVKKDELEELFLIQDFNDEQKKDIDAMTSSLINKILAPYTNSVKQFIKENKNFDYILNEYKKMLEQFMENIVKKL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828)
Length
401 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.302 kDa
Sequence
MIIMIPIYAITWNFRDTPEGFDKIVNNDYNYFESLCKKSSIDEFVILITCNRVEIYAYTRNEIDKDLFKDSLIYNYPESTMHLLRVASGLESMSIGENDIMRQVKEAYELSIKRKTSGKILSYIFKKALNVGKEVRTQTSISRGKTSIPAISLDICDNEYGINNKSILIIGNGKMATDFSRYLKEYRPGNVTIAGRSIDHARNLAVLYGYSYDSIKNLNNLIKNSDIIIAATSAGNYIVKDLGDLARNKYFIDISKPENIDPEISKYARLLSINEIGKILKRNEDEKKGEVEIAEVIINQEQKTIDEKLKEMMLDDVIAMFYKFANNVKKDELEELFLIQDFNDEQKKDIDAMTSSLINKILAPYTNSVKQFIKENKNFDYILNEYKKMLEQFMENIVKKL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Length
401 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.919 kDa
Sequence
MIGLIGIRKNTPLEIREKFIVKSKKYNEYFGELLKELNEVVILATCNRTEIYFNASLNEEELLKKIFDIFNWDYEYKKYVFITNNKDAYRHLFEVCSGFHSKILGEDQILGQVKDAYEEALEFKAVSLELHRLFQEAITCGKRFRKEAKLFEIPVSSSSIVVSEAIKRECTKFMVLGYGEVGQLVMKYLLSHKIQTVYLVVRNPKIKDEIQDERVKVITFEEKNKYINSIECIISCTSAPHPVVKTEDISESGSRLVIYDLSVPRDVEKEVALLSRTEVYNIDTISRIDDENKKLRKDKMEDNRHIMNKYLKEYDEWLKLRSISHVIKNLKTVGNDVYEKRVQTFSHKSKDKNDIALAHKLIKSTSDFYINRAIEVIKEETLKGCGEEWIGIIEKIFMTKE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium botulinum (strain Alaska E43 / Type E3)
Length
401 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.076 kDa
Sequence
MIAVLGIKRNTPIEIREKLTIKANKHDEYLDRLLKYLDGVIILATCNRTEIYFNVSFINEELLKKIFEIFNWNYSYRKYIFISEDKKACKHLFEVTCGFHSKILGEDQILGQVKTSYFKSLNAKALNLELQRLFQYAITCGKKFKSQSRLFEIPVSSASIVVNESINKDCKKFMVLGYGDVGRLTMKYLLAHNINEVYLAVRNKKIKDEIVDERVNVIDFEEKNKYINDMDCVISCTSAPHIVIKKQDINNIGDNILIYDLAVPRDVDDEINDIDRAQVYNIDNISYINDGNKKMRFDKMDSNKFILENYLNEYYEWKRLRSIAPFIEELKVTSKEIYDKRITTFKNKCKYRGDVDLANKMIKSTSDYYMNRAIEIMKEETLKGSEEECLRIIKSIFIAKK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium botulinum (strain Eklund 17B / Type B)
Length
401 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
47.009 kDa
Sequence
MIAVLGIKRNTPIEIREKLTIKVNKHDEYLDKLLKYLEGVVILATCNRTEIYFNVSSINEELLKKIFEIFNWNYSYRKYIFISEDKKACKHLFEVTCGFHSKILGEDQILGQVKTSYFKSLNAKALNLELQRLFQYAITCGKKFKSQSRLFEIPVSSASIVVNESINKDCKKFMVLGYGDVGRLTMKYLLAHNINEVYLAVRNKKIKDEIMDKRVNVIDFEEKNKYINDMDCVISCTSAPHIVIKKQDINNIGSNIIIYDLAVPRDVDDDINDIDRAQVYNIDNISHINDGNKKMRFDKMDSNKFILEKYLNEYYEWKRLRSIAPFIEELKVTSKEIYNKRITTFKNKCTDKDDVDLANRMIKSTSDYYMNRAIDIMKEETLKGSEEECLRIIKSIFMTKK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Length
400 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.91 kDa
Sequence
MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFNVFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKGAYKTAISDNSISSELQKMFEIAIACGKKFKTECKMFEVPVSSVSISINSALLKGCRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKASDLEGEIVEVLDFNEKNQVINEIDCIVSCTAAPHTVVRNEDIKTEGETIHIYDLAVPRDVDKELSEKERVILKDIDEISKIDDKNKKIRKERMEEYKHIVEESIDEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNKGNGENAKLAERMIKSTADAYVNRAIELLKSEALKGSDSYCAEIIEKIFLT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium perfringens (strain 13 / Type A)
Length
400 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.89 kDa
Sequence
MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFNVFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAIACGKKFKTECKMFEVPVSSVSISINSALLKGCRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKASDLEGEIVEVLDFNEKNQVINEVDCIVSCTAAPHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELSEKERVILKDIDEISKIDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNKGNGENAKLAERMIKSTADAYVNRAIELLKSEALKGSDSSCAEIIEKIFLT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium perfringens (strain SM101 / Type A)
Length
400 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
45.912 kDa
Sequence
MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFNVFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAIACGKKFKTKCKMFEVPVSSVSISINSALLKGCRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKASDLEGEIVEILDFNEKNHVINEVDCIVSCTAAPHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELSEKERVILKDIDEISKIDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNKGNGENAKLAERMIKSTADAYVNRAIELLKSEALKGSDSSCAEIIEKIFLT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Length
399 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
44.99 kDa
Sequence
MILNLRVDHKIANIDAMENIAKEMDQLFLELQEKYSIVEYVEISTCNRKEYYIHNDNIDASDSLLSHENKSIIIDYGDSVIKHLFRMTSGLESMIVGEDQILGQVSDAKQKAFKERHCGKILDSIFTKAIHVGRVVRNKTNINKGSISIGSAAVDLAEKHLGNLENKSVLVIGAGKMGKLVAKALAEKNLNAIFVANRTYYVAVELANDLNGHAVLFNELGKYVQTADLIISATGAPHYILNKERLEKTDGDFKDLLMIDIANPRDICEDVCELGVKLFNIDDLREIADENTKLRKKEFAEAENIIDEEFSLLKESFKLIGVEDIIANLRVSMENIRERETEKAIAKLSDVDANAKIIDNLTNSIVNKIFFDISKKIKQAAHENDEELIRAIEFMFEEK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium kluyveri (strain NBRC 12016)
Length
399 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.435 kDa
Sequence
MIQLIGIKSQCDIGIRQKFSITSEVLEGKLKYINELVGSVLILSTCNRTEIYVDSNLEEKKLIDTVFYGLDWDYDLVSYIFYIKDKYAIKHLMEVSCGFHSKILGEDQILGQIKTAYDAALEAKTIKGKLQRLFQKAITCGKEFKHICESYRIPVSIPSIVAKEILNMDIRKYMIIGFGKIGQLLFKYLNNSQAQIIYIAVRDLNKVHDSYKKCGKIRFISFKDRKSYYNDIDCIVSCTSAPDKIISKGDLPCRKLTIFDLAVPEDIDRNVLDLDNVTLYDIDNISVIDEKNKAIRKKTMGKYRYILENHIDKFIKWEKLHQLSPEIQKVKKYGDEICEKRITTFKNKKHTKDNDILVKTMIESTARFYINRAIEVMKEEKLNGREEECLRLINKIFCK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Length
399 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.435 kDa
Sequence
MIQLIGIKSQCDIGIRQKFSITSEVLEGKLKYINELVGSVLILSTCNRTEIYVDSNLEEKKLIDTVFYGLDWDYDLVSYIFYIKDKYAIKHLMEVSCGFHSKILGEDQILGQIKTAYDAALEAKTIKGKLQRLFQKAITCGKEFKHICESYRIPVSIPSIVAKEILNMDIRKYMIIGFGKIGQLLFKYLNNSQAQIIYIAVRDLNKVHDSYKKCGKIRFISFKDRKSYYNDIDCIVSCTSAPDKIISKGDLPCRKLTIFDLAVPEDIDRNVLDLDNVTLYDIDNISVIDEKNKAIRKKTMGKYRYILENHIDKFIKWEKLHQLSPEIQKVKKYGDEICEKRITTFKNKKHTKDNDILVKTMIESTARFYINRAIEVMKEEKLNGREEECLRLINKIFCK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium tetani (strain Massachusetts / E88)
Length
399 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.358 kDa
Sequence
MIGVLGVKTEVKLDIREKLSIIPKRYESSLMKLKEKCDEVVILSTCNRTEVYYSYKKHNENIISHIFKCLNWDENYKKYTFHYKDDEAINHLMRVICGFDSLILGEDQILSQIKQAYEIALSSKSVNRDLNKLFQMAITCGKEFRNKSQLYKIPVSSASIAVNEGRKHGGKNFMVLGYGAVGSLAVKYILSGEFDKLYIVVRNPSVVDLRDDRMTIINFNERGKYYKDVDCIISCTSAPHVVVDAFELPKHKNIVVYDLAVPRDVDEEVRYMKNVKLYDIDNISCINDENCSKREDIMNNNLFVIEKYEREFEKWRKTSEISPHIVNLKKKGDEVYKKRLTTFKNKKYTKDVDALAEIMLKSTSNAYINKAIEVLKEEQLKGRGEECLRIIEKIFYSAQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Length
398 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
44.536 kDa
Sequence
MILNIRLDHKTSDVKTMETASGRIEEIVGELEALGAVTEKVPLMTCNRVEYYLHVTGVPPEFDFNGFTVEKDEDALLHLLRLASGLESMIIGEDQILGQIKAARLQALREGTCGPLLDMVFTKAVHVGQTVRRKTKINRGSVSIGSAAVDLAESIHGDLKCKKVLVIGAGKMGTLVARALAEKHLKAIMVANRTYERAYQLACELGGDAIHFDRLNRALRDADVVISATGSPHYILTRERVMDAVPPERRSSIVMVDIANPRDIEESVRELGVRLFTIDDLRGVAEENRKRREAEAREAEGIVRAELELLLRAMKHREVEPLLAEIRGRMESLRQREAGKAIKKIENSKDPERVVEGLTRSIVDKIFHDIALKIRDAAERDDREFLRMCSELFDCDES

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)
Length
397 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.63 kDa
Sequence
MDLLAPLAAVILTYREVDADTLGRVGEEMKKCIEILGVKRPMFVLHTCGRVEAYLYNASEEEINSVTLRYRRYAESIRVVRGVEAARHLFRVAAGLESMLIGETDILGQVEEAFDRQVKAGFTKGLLKTIVERAIRAGKRVRAETGISRGPAGLGSLSIIYVSQLLDLTKSKVAVLGAGAVGAGLAKELAERGVAKLYILNRTLEKAVEIANKLGAEARPLTREEVQKCLMECDVVFSSVHSLEYVIDRVPDGAVVKIIVDLGVPQTVAPGLPVRVVRLSDLKQLAEKYSEARKQEAARAEAIVEEELAKLPQILARRYIEEAVSHLLEKAMEVAEEEGKRAGCPTAVLAARTTVKRTLFPIIEVLKKMAEDGRLEDAVKVVEILRSQKPLLRQSEE

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Length
396 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.275 kDa
Sequence
MIQLLALKRDLKVEIREKFSIIEKRIGDKDVLLKEVCNEVVILSTCNRIEIYFNSEKNRKQIIEEIFSKMGWNINFLENFFYCKGDEAINHLMEVACGFDSLILGEDQILGQIKAAYDTALKNKTSGSELKKLFQLVITCGKEFRSISMLNRIPVSSASIAVNKARQENLRRFMVFGFGDVGSLVCKYILSSDFDVLYIVVRNKAAVSIKDKRIKVLSFNEKNSYYDDVECMISCTSAPHPVIWEKELPYRKFTIFDLAVPRDVEETVYGRNNIDIYDIDQISMIDNNNRKKRKEIMMANRHIMSKYIVEFYDWQKVQEIVPDIIKLKLYGESVNKRRYETFKNKKATKDNDMLVNMLIKSTSNVYINRAIEVLKEEQLKGRGEDCLRILRRIFQK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Length
395 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
44.733 kDa
Sequence
MLVNIRIDFKIADIETMEKSYAKLDMINAELHEKLDILEEVTLKTCNRYEIYLLIDEEVNIPTTTFIVEKNDMAINHLLRLASGLESMIMGEDQILGQIKTARKNAIKNKTIGPKLEKVFTKAIHVGQTIRKNTHINEGGVSVGSGAVELIEEKYGSLKGKNVLIIGAGEMGTVVSKALLEKETNTIVVANRTYDKARQLAQELDGEAIKFDEMNNELVNIDIVISSTGAPHSIISKERIAFLPEEHLHDMIMLDLANPHDIENDVQELGVKLYNLDDLRYVTDKNKERRNKEAIKAEAIIEDETLLLKESLKQMEITPILSSLNIEAEKIRKQELDKTLHMLDLDKKSSKKVDYLTRSITDKLLYNIINNLKEAAANNDKDTIRNAKKILLEYN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320)
Length
394 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.38 kDa
Sequence
MLWVIGINHKVEVDIRQKFSLIKTKLQEKLISLKKLANEVIILSTCNRTEIYFFSEEYVDIEKIFTELDWDKRYMHLFYIYKDKDCIKHLFEVVCGFDSLLIGEDQIVAQVKEAKEISKLVGGKNPVLERLFEVALKCSKEFRTKARLNEHPITIASVVGKVLKESNIRKIAIIGLGNIGILFCNYFKNSDVDKVFLIGRKNEKIDQFVKLNPEKFRYYDKKKTILEAQCLICSTSAPHSVVHKDDIPEGKNLLIFDLAVPRDVDVEVYELPNVKVIDIDQVHKIDTINREFRISKMQENYHIIDKYVDEFIDWLEFRQYRNLIMEMKRHAEQLCKAQVKYIKNVDSRERKEVERLLIRMANLYIDRAIEVLREAHKEGSGEICSNLIKRIFLK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Length
394 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
46.005 kDa
Sequence
MLWVIGINHKVEVDIRQKFSLTKTKLQEKLISLKKLADEVIILSTCNRTEIYFFSEEYVDIEKIFTELDWDRRYMPLFYIYKDKDCIKHLFEVVCGFDSLLIGEEQIVAQVKEAKDIAKQVGGKNPVLERLFEVALKCSKEFRTKARLNEHPITIASVVGKVLKESNIRKIAIIGLGNIGFLFCNYFKNSDVDKVFLIGRKNERIDQFVKLYPGKFEYSDKKDAISEAQCLICSTSAPHAVVHKDDIPDGKNLLIFDLAVPRDVDVEVYKLPNVKVIDIDQVHKMDATSREIRISKMQENYNIIEKYIDEFIEWLGFRQYRNLIIEVKRHAEQLCKAQVKYLKNVDSREREEVERLLIRMANLYIDRAIEVLREAHKEGSGEICSNLIKRIFLK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Length
393 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.011 kDa
Sequence
MDLLSPLSAIVLTYREVDTDTLGKIGEEMRKCLEQMGRGTPIYVLHTCGRVEAYLYGASPEEVQTVAETYRKYVNSVRIIAGVEAARHLFRVAAGLDSMLIGETDVLGQLEEAFDRQVRAGYTRGLLKTIVERAVRVGKRVRTETAISRGPRGLGSLSIIYVSRLLDMRQAKVAVLGAGAVGAGLAMELAARGVKKLYILNRTLEKAKEVAAKTGGEARPLTKEEVERCLRECDVVFSSVHSMEYIIDKIPEGASVKVVVDLGVPQTVASGLPVKVVRIEDLREIAEQYNAERASEIAKAEAIVEEELAILPKLLARRYIEETVSTFIETAMLAAEEEGARAGCNTATLAARTTVKRILLPLVERLKKMAEDGQIEEAVKLAQMLSQTIGRKI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta)
Length
393 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
42.756 kDa
Sequence
MDLLAPLSAVVLTYREVSAEALGKVGQEMKRCIERRARAFPMYVLHTCSRVEAYLYGAPPEEVQEVAEAYRRYVDSVRVITGAEAARHLFRVAAGLDSILIGETDVLGQVEEAFDRQVRAGYTRGLLKTVVERAVRVGKRVRTETAISRGPRGLGSLSIIYVSRLLDLRQAKAAVLGAGAVGSGLAMELASRGVGKLYILNRTFEKAREVAAKTGGEARPLTREEVERCLRECDVVFSSVHSMEYVIDRVPEGASVKIVVDLGVPQTVAPGLPVKVVRIEDLRQVAEQYNAERAAEVAKAEAIVEEELAALPRLLARRYVEETVAALLETAMTAAEEEGARAGCDAAALAAKTTVKRVLLPLVEKMKKMAEDGQMEEAVRLANVLTQAVGRKT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Length
392 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
44.847 kDa
Sequence
MIILKADYKKYNVSELEKLRMDEEKFYETFDNAILLQTCNRVEIIFDADSLEEIKGIENIDLEKFDILFGDKAIEHLFRVACGLESMIVGEDQILGQLKNAYLKAKEKGRISKKLEKIILKAIHTGQRARVETKINEGGVSIGSAAVELAEKIFGLEGKNVLLIGAGEMANLVIKALKEKNIKAIIVANRTYEKAEKLAKELGGMAIKFDKLEEALRYADIVISATGAPHPILNKERLKNAGKTIIIDIANPRDTTDDIRELPDIFLFTIDDLRLVAEENLKKRKEEIPKVEMIICEELERLKEFLDKMRFETAIKELGQYIENVRKKEVEKAKKILKNKNKPVEEVLEDFSKALCKRIIYDIIKIFENVEDKEVFECLAKEFKKLGNKNKN

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
Length
390 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
41.965 kDa
Sequence
MALPLYLVGLSHKTAPLEVRERAALDPVVALPAALSALGKGVVLSTCNRTELYGVGSPEKARAFLLSRGVVPRHLYVKEGVEALRHLYRVAAGLDSLVVGEAQILGQVREALFLARRQGATESLLEKAFQSAIALGKRARSETGIGMGAVSVAYAALDLALAVYGDLSGLSVAVLGAGEMAELFLTHLKAHGVGRILVVNRTEEKAQALAERFGGEAFGLPALPQVLRQADLVVASAAAPHYLVGPEDLPKRAKPLFLIDIALPRNIDPRVGDLPHAYLYNLDDLKRVVDRNLRARAGEIPKVEALIEKALGDYMEWYAGHRVREAIRALEAWARVQAAKAQPEAGPVELEKAAGRLAHPFILGLKRRALDRVGGPPCPEDCLLYRLSRT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Length
390 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
41.937 kDa
Sequence
MALPLYLVGLSHKTAPLEVRERAALDPVVALPAALSALGKGVVLSTCNRTELYGVGSPEKARAFLLSRGVAPRHLYVKEGVEALRHLYRVAAGLDSLVVGEAQILGQVREALFLARRQGATESLLEKAFQSAIALGKRARSETGIGMGAVSVAYAALDLALAVYGDLSGLSVAVLGAGEMAELFLTHLKAHGVGRILVVNRTEEKAQALAERFGGEAFGLPALPQVLRQADLVVASAAAPHYLVGPEDLPKRAKPLFLIDIALPRNIDPRVGDLPHAYLYNLDDLKRVVDRNLRARAGEIPKVEALIEKALGDYMEWYAGHRVREAIRALEAWARVQAAKAQPEAGPVELEKAAGRLAHPFILGLKRRALDRVGGPPCPEDCLLYRLSRT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Length
383 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.752 kDa
Sequence
MLLFRADYNNYAVSELQKLRFDEDEFYKKYDNCVLVQTCNRIEIYFDKNAKIIDINEFAEFEMIKSNNAIKHLLRTASGLNSMIVGEDQIIGQIKNSHRKAKELKKTTKYLDTIFLKAIHTGQKVRNNTKINKGCVSIGSAAVQLAEKTVGLNNKNILVVGAGEIATLVAKALIEKNIRAIVVSNRTYERAELLAKKLNGMAVHFDKLGEAINYNDIIICATGAPHAIIDKDRLKNIKGYKVLIDIANPRDVSDDVMELPNIKLYTIDDLKMVSEENLKKRKDEIPRVEKIIEEELSVLTKQLRKLKFENTIKNYDLYIENLRKREMNKALNMIENGKDPTVVLEKFSKVFANKLISDFVNIVNDDTIGDIERVVNKLNKNKI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Length
382 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.554 kDa
Sequence
MLVVRADYKKYPVPVLEKMRIDEDEFYNKYDACVVVQTCNRIEAYFDTEINSNVDGILKDFQGFDVLKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQKARELKKTSRYLDSLFLKAIHVGQRARTETKINEGGVSIGSAAVELAEKNFGLANRNVLLIGAGEMGTLVAKALIEKHIKAVIVANRTYERAETLAKELKGMAVHFDKLKEAINFSDVIICATSSPHHILEKKDLIDVGNKIIIDIANPRDVDDSVRELENIELYAIDDLRHISDKNLQSRIEEIPAVEKIIDEEYEVLMKQIEKINVEEVLKEFNNYIEEIRVKELEKAIKLSKTKNPEEIMENFSKAFAKRITHDFVSYSINTSKEDLMNSAWWKNGK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Length
382 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.638 kDa
Sequence
MLVVKADYKKYPIPVLEKMRIDEDEFYKKYEACVVVQTCNRIEAYFDTEVNSDIDCILNDFSGFDVLKGKTATFHFLRVSCGMESMILGENQILGQIKTSFQKARELKKTSRYLDGLFLKAIHVGQRARTETKINEGGVSIGSAAVELAEKNFGLTNRNVLLIGAGEMGTLVAKALLEKHIKAVIVSNRTYERAETLAEELKGIAVHFDKLKEAINFSDVIICATSSPHYILKKEDLNDVGNKIIIDIANPRDVDDAVREFENIKLYTIDDLRNISDKNIQKRVEEVPAVEKIINEEYEVLMKQIEKINIEEVLKDFNSYVEEIRVKELEKAIKLSKTKNPEEIMENFSKAFVKRITHDFVSYSINTSKEDLMNSAWWKNGK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Length
382 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.779 kDa
Sequence
MLVVKADYKKYPIPVLEKMRIDEDEFYKKYEACVVVQTCNRIEAYFDTEVNSNVDDILKDFQGFDILKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQKAREFKKTSRYLDSLFLKAIHVGQRARTETKINEGGVSIGSAAVELAEKNFGLTNRNVLLIGAGEIGTLVAKALVEKHIKAVIVANRTYERAETLAKELKGMAVHFDKLREAVNFSDVIICATSSPHYILEKEDLIDVGNKIIIDIANPRDVDDSVRELENIELYTIDDLRNISDKNLQRRIEEIPTVEKIIEEEYDVLMKQIEKINVEEVLKEFNTYIEEIRVKELEKAIKLSKSKDPEEIMENFSKAFAKRITHDFVSYSLNTSKEDLMNSAWWKNGK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanococcus maripaludis (strain S2 / LL)
Length
382 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.612 kDa
Sequence
MLVVRADYKKYPIPVLEKMRIDEDEFYKKYDACVVVQTCNRIEAYFDTEVNSDLNCILNDFSGFDILKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQKARELKKTSRYLDSVFLKAIHVGQRARTETKINEGSVSIGSAAVELAEKNFGLANKNVLLIGAGEIGTLVAKALMEKHIKAVIVANRTYERAETLAKELKGMAVHFDKLKEAINFSDVIICATSSPHYILKKEDLIDVGNKIIIDIANPRDVDDAVREFENINLYTIDDLRNISDKNLQKRIEEVPAVEKIIDEEYDVLMKQIEKINVEEVLKDFNNYIEEIRTKELEKAIKLSKTKNPEEIMENFSKAFAKRITHDFVSYSINTSKEDLMNSAWWKNGK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Length
379 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
43.233 kDa
Sequence
MLVIKADYKKYPLPVLESMRINEDEFYGKYDACIIVQTCNRIEAYFDEEINDIEKIIPDFKGFDVIKGKKATLHFLNVACGMDSMILGENQILGQIKSSYHKSKELKKTSKYLENLFLKAIHVGQRVRAETKINEGGVSIGSAAVELAEMKLGLKNRNVLLIGAGEIGTLVAKALIEKHIKAVIVANRTYERAETLAKELKGMAVHFDKLKEAINFSDVIICATSSPHYILEKSDLLDVGNKIIIDIANPRDVDDSVRELENISLYTIDDLRNISDKNLQKRLKEVPIVENIIEEEYGILLKQIEKTNVEEVIKDFNTYIEDVRKKELEKAVRLCKNKSPDEIMENFSKAFVKRITHDFVSYSLSVSKEDLLNSIWWKK

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Length
368 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
42.784 kDa
Sequence
MKLNLVGLGRNTPIYILEKFDFDEQEFFSSLKVKTTEVAVLKTCHRREIYYIGDKEPLTINEIIEPYIIRKSGIDVVRHLFKVSCGLDSMVLGEHQILSQVKNTHKNFCHGKILNKLFNEAVSLGKEARTKTGINKYPLSISYIAVKLIEEQINIEGKKIFVIGTGMMGQKVIKYLVSRGADIYISNRTIKKAYEIKKMFSEVNIVDFEEKYKHISSSDVVISATNAPHYVVEEKKVNSQKNIIFIDLSMPRNIEPSIKEYHTLYTLEDLNEISKKYNKLRQEKISTIQNLIETRIKKFLTWYKLQTVKDDILYIQNLAEKLVYEEIEKLSKKILLDDNSLKQIQKSLKSCTKKIVSYHINYIKEKVI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Length
350 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
37.529 kDa
Sequence
MPQPAPLDFVVVGLNHQTAPVEVRERVAVRPEEEGALLGHLARHADEVLLLATCNRTEVYLAGVHGDPLAAFEGAWGHALLDHLYVYRGEAAVRHLYRVTAGLDSLVIGETQIQGQVKRAWQSARERGLSGTLMNKVVQGALAAGKRVRSHTGLSDKVVSVSSAAVELAQAALGELSQRRALILGAGETAELTLTHLRAAGVQDVLVVNRTAERARALAEKLGGRACPAEELSAALPEVDVVIASSAAPHYVVTAQNVREALAGRPGRAMFLIDISVPRILDPEIASVPGAHLYNLDDLTAVVQRNMQSRRAALPQAEAIIRELGSDLSRWYLTRETQLARQAELALACD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Length
350 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
37.529 kDa
Sequence
MPQPAPLDFVVVGLNHQTAPVEVRERVAVRPEEEGALLGHLARHADEVLLLATCNRTEVYLAGVHGDPLAAFEGAWGHALLDHLYVYRGEAAVRHLYRVTAGLDSLVIGETQIQGQVKRAWQSARERGLSGTLMNKVVQGALAAGKRVRSHTGLSDKVVSVSSAAVELAQAALGELSQRRALILGAGETAELTLTHLRAAGVQDVLVVNRTAERARALAEKLGGRACPAEELSAALPEVDVVIASSAAPHYVVTAQNVREALAGRPGRAMFLIDISVPRILDPEIASVPGAHLYNLDDLTAVVQRNMQSRRAALPQAEAIIRELGSDLSRWYLTRETQLARQAELALACD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Deinococcus geothermalis (strain DSM 11300)
Length
349 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
37.531 kDa
Sequence
MPPLAPLDFAVIGLNHQTAPVEVREQAAVRAGDEGKVLQHLSRYAREVMLLNTCNRTEVYLAGLQGDPLRAFESGWGRALDGHLYVHRGEAAATHLYRVAAGLDSLVIGETQIQGQVKRAWQEAHARGLSGTLLNKVAQGALAAGKRVRSETGLSDKVVSVSSAAVELAEAALGELRHRTALILGAGETAELTLTHLRAAGVQDVIVVNRTEARARQLADKLGGRACAAEYLHEVLPEADVVIASSAAPHYVLHGEGVRAALAKRPERPIFLIDISVPRILDPDIRAVSGAHLYNLDDLTAIVSRNLQSRRAALPYAEAIIREAVADLLRWHLTREAQLGRRAVALASD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Deinococcus geothermalis (strain DSM 11300)
Length
349 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
37.531 kDa
Sequence
MPPLAPLDFAVIGLNHQTAPVEVREQAAVRAGDEGKVLQHLSRYAREVMLLNTCNRTEVYLAGLQGDPLRAFESGWGRALDGHLYVHRGEAAATHLYRVAAGLDSLVIGETQIQGQVKRAWQEAHARGLSGTLLNKVAQGALAAGKRVRSETGLSDKVVSVSSAAVELAEAALGELRHRTALILGAGETAELTLTHLRAAGVQDVIVVNRTEARARQLADKLGGRACAAEYLHEVLPEADVVIASSAAPHYVLHGEGVRAALAKRPERPIFLIDISVPRILDPDIRAVSGAHLYNLDDLTAIVSRNLQSRRAALPYAEAIIREAVADLLRWHLTREAQLGRRAVALASD

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
Length
340 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
37.606 kDa
Sequence
MRMVCLGLNHRTAPVEIRERFAVPSHKLREEGQRIRSLPGVDQCVVLSTCNRMEIYYWSNAPENAQEHILSHFLGDGRGELDMASYFYSHQGEDALGHLCRVLSGLDSMVLGETEIFGQVKTAYQTALDAGVTAACANKTFQKAFTIGKKVRTESQIHAGATSVGSVAVELAEQIFGDLSGTRVLILGAGEMSRVTGRALHARGAEGIYVANRSFDRAVELAGMIGGQAIRYDVWGNYLRDIDVVVAATAAPHCIITRETLLPLRASRKYRSLFLIDISVPRNISPDVADIDEVYLYDIDTLTQLADEAKRSRKQEVSRCEAIIRDSISRYFPDSALYDQ

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia pneumoniae
Length
339 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
39.104 kDa
Sequence
MVLGVVGISYREAALKERERAIQYLQSFEKNLFLAQRFLGKGGAFIPLLTCHRAELYYYSESPEIAQAALLSELTSQGIRPYRHRGLSCFTHLFQVTSGIDSLIFGETEIQGQVKRAYLKGSKERELPFDLHFLFQKALKEGKEYRSRIGFPDHQVTIESVVQEILLSYDKSIYTNFLFVGYSDINRKVAAYLYQHGYHRITFCSRQQVTAPYRTLSRETLSFRQPYDVIFFGSSESASQFSDLSCESLASIPKRIVFDFNVPRTFLWKETPTGFVYLDIDFISECVQKRLQCTKEGVNKAKLLLTCAAKKQWEIYEKKSSHITQRQISSPRIPSVLSY

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia abortus (strain DSM 27085 / S26/3)
Length
338 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.3 kDa
Sequence
MVLGVVGISYREAALKEREAVINILKDFEANSFFSQHFFGDDGSFVLLLTCHRAEIYYFSKSNRHIQSKLLSRISSLGARPYCYQGLACFTHLFTVTSGMDSLISGETEIQGQVKRAYIKAKTDRDLPFALHFLFQKALKEGKDFRSQVSLSHPVVTIESVVEETLDLHGKSTKDKLLFIGYSEINRKIAKGLSAKGYRNLIFCSRKNISIPYDTVARSQLSFREPYDVIFFGSSESAKDFSGLSLESLASIPSRVIFDFNVPRTFTLAESPKDIICLDMDFISERVQKKLQISKQCTNKEKPFLALAARKQWEVYEKKSSHIPSSQVRASRPKLLIL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydophila caviae (strain GPIC)
Length
338 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.246 kDa
Sequence
MVLGVVGISYREAALKEREAAINILKDFEANTLFSQRFFGGEGSFVLLLTCHRAEIYYFSKSNHNVQSELLSRISALGARPYCYQGLACFTHLFTVTSGMDSLISGETEIQGQVKRAYIKAKTDRELPFALHFLFQKALKEGKDFRSQVSLSHPVVTIESVVEQTLDLHGKSTKDKLLFIGYSDINRKVANGLSAKGYRNLIFCSRKNISIPYATVARSQLSFREPYDVIFFGSSESAKDFPGLSLENLASISNRVIFDFNVPRTFTLMERPKDIVCLDMDFISEQVQKKLQISKQCTNKEKPFLALAARKQWEVYEKKCSHISSSQLQTSRPKLLIL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia felis (strain Fe/C-56)
Length
338 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.262 kDa
Sequence
MVLGVVGISYREAALKEREAVINILKTFEADTLLAQRFFGGDGSFVLLLTCHRAEIYYFSKSNANVQSKLLSWISSLGTRPYCYQGLACFTHLFTVTSGMDSLIFGETEIQGQVKRAYIKAKTDRELPFALHFLFQKALKEGKDFRSQVSLSYPVVTMESIVEETLDLHGKSTKDKLLFIGYSDVNRKIAKGLSAKGYRNLIFCSRKNIPIPYDTVARSQLSFGKPYDVIFFGSSESARDFPGLSLESLAGIPNRVVFDFNVPRTFTLVERPEGISYLDMDFISERVQKKLQISKQCTNKEKPFLALAARKQWEVYEKKSSNISLSQIRTSRPKLLIL

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B)
Length
335 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.868 kDa
Sequence
MVREGEERIGNRVLLGVIGVSYRETTLQQREQVLHILQQAQGSFRPEVFQEERDYVLLATCHRVELYSVAPAELFDSLAQEIKLLGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKALKEGKVFRAKGGAPYAAITIPILVDQELRRRQIDKKASLLFIGYSEINRSVAYHLRRQGFSCITFCSRQQLPTLSMRQVVREELCFQDPYRVVFLGSLELQYALPHSLWESIWDIPDRIVFDFAVPRALPSHTVFPHRYMDMDQISDWLREHRKEVNSAHLDSLREVAYRYWNSLNQRLERHDCVGANA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Length
335 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.843 kDa
Sequence
MVREGEERIGNRVSLGVIGVSYRETTLQQREQVLHILQQAQGSFRLEVFQEEKDYVLLATCHRVELYSVAPAELFDSLAQEIELLGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKALKEGKVFRAKGGAPYAEITIPILVDQELRRRQIDKKASLLFIGYSEINRSVAYHLQRQGFSCITFCSRQQLPTLSMRQVVREELCFQDPYRVVFLGSSELQYALPHSLWESIWDIPDRIVFDFAVPRALPSHTVFPHRYVDMDQISDWLREHRKEVNSAHLHSLREVAYRYWNSLNQRLERRDCVGANA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Length
335 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.868 kDa
Sequence
MVREGEERIGNRVLLGVIGVSYRETTLQQREQVLHILQQAQGSFRPEVFQEERDYVLLATCHRVELYSVAPAELFDSLAQEIKLLGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKALKEGKVFRAKGGAPYAAITIPILVDQELRRRQIDKKASLLFIGYSEINRSVAYHLRRQGFSCITFCSRQQLPTLSMRQVVREELCFQDPYRVVFLGSLELQYALPHSLWESIWDIPDRIVFDFAVPRALPSHTVFPHRYMDMDQISDWLREHRKEVNSAHLDSLREVAYRYWNSLNQRLERHDCVGANA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia trachomatis (strain D/UW-3/Cx)
Length
335 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.855 kDa
Sequence
MVREGEERIGNRVSLGVIGVSYRETTLQQREQVLHILQQAQGSFRPEVFQEERDYVLLATCHRVELYSVAPAELFDSLAQEIELLGVSPYFYRNQDCFAHLFCVAGGLDSLVLGETEIQGQVKRAYLQAAREQKLSFALHFLFQKALKEGKVFRAKGGAPYAEITIPILVDQELRRRQIDKKASLLFIGYSEINRSVAYHLQRQGFSCITFCSRQQLPTLSMRQVVREELCFQDPYRVVFLGSSELQYALPHSLWESIWDIPDRIVFDFAVPRALPSHTVFPHRYVDMDQISDWLREHRKEVNSAHLHSLREVAYRYWNSLNQRLERRDCVGANA

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Alkaliphilus oremlandii (strain OhILAs)
Length
334 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.048 kDa
Sequence
MNIIMAGIDYKLAPIDVREGFSFTKAMMKQVYSNILKDTMIYGTVIISTCNRTEIYISCEEDFCVNPFEVLCNAAGIDFTPYEKVHRVKEGDEVIKHLCQLACGVKSQIWGEDQIITQVKNAIAVSREMRAADSYLEVMFRNAIAAAKKVKSTLILNSRENSIVHKALKIIKDQETMNIREILVIGNGEMGRLMTNVLIENGYRATMTLRQYRYHANVIPLNANTVDYSNRYEKMKDCDVVISATLSPHYTVEMENLKKIDKIPKLFIDLAVPRDIDPSIKNLPNIELYDVDGIGADEISKNHAQQLKGIERIIEKYICDYHKWCLFKEGLGCI

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Chlamydia muridarum (strain MoPn / Nigg)
Length
333 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
39.016 kDa
Sequence
MVREGEEHIDEEFSLGVIGVSYRETALQQREQVLQFLQQAQLSFYPKFPQEEGRSVLLSTCHRVELYGMATEAIFSTLEKEIREMGAIPYFYRNQDCFSHLFCVVGGMDSLVLGETEIQGQVKRAYLQAIEEQKLAFALHFLFQKALKEGKVFRTKRSSPSTEITIPAFVQHELQKQKMARSASLLFMGYSEINRSVAYYLQKQGFSRITFCSRQPLSLRSMDQVLREEVCFQDPYHVIFLGSSELRHAFPRSLWEGVWDFPGRLVFDFAVPRALPVQPACRDRYIDMEQISDWLRQHQKEVFPLQLDSLREVGYRYWESLNRRLARRRYASV

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Length
331 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.025 kDa
Sequence
MNVIMAGIDYTLAPIDIREKFSFTKSTLQAVYNDLLKNENIFGAVIVSTCNRTELYLSCEEGLYINPFELLCDAANFDYEEYSNMHVLRTGVDVIRHLCELACGVKSQIWGEDQIITQVRNAIELAREMNASDSTLEVMFRIAVTSAKKVKTTLKLSSTERSIAYSALKIIKSKENISKALVIGNGEIGRLMASILIENGYDTTITLRRYRHGDNIIPLGAKTIEYVARYEKLKDCDVVISATLSPHYTLEIDKIDRIKYPRLFIDLAVPRDIDPKIKSLDNVELYDLDSIYAGEVDKNRTEQMIQVKKIIDKYIFDYYRWYEYRKRLVLT

Gene
hemA
Protein
Glutamyl-tRNA reductase
Organism
Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
Length
329 amino acids
Function
Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
Similarity
Belongs to the glutamyl-tRNA reductase family.
Mass
38.592 kDa
Sequence
MLDLENIIVIGVSHENLSLLERENFMRTRPKYIIERLYTEKKINAYINLSTCLRTEFYIELNSNIKAKEIKNLFSVDMIVKSRVEAIEYLFKVGCGFYSVIKGEDQILAQVKGAYAEALENEHSSKFLNIIFNKSIELGKKFRTKSMIAHNALSLEAISLKFIKSKFPNIEDKNIFILGIGELAQDILTLLTKEQLKNIYIANRTYHKAEQIKKEFDIVNIVDYREKYPKMIEADVIISATSAPHIVVEYDKFVAQMKENKDYLFIDLAVPRDVDERLANFKNIEIYNLDDIWEVYHLNSMNRDKLLEDYSYLIDEQMEKLIKTLNYYK