hap5

Transcriptional activator hap5

415 amino acids

Component of the CCAAT-bound heteromer, php5 is essential for DNA-binding activity. It is essential for transcription activation of cyc1. It is the linchpin that binds to the subunit association domains (SAD) of php2 and php3 to bring these proteins together.

Belongs to the NFYC/HAP5 subunit family.

46.674 kDa

MNSIPDSYSLKQGFPEGLGEYVDPSGNPNSQVRIGYGQDSVSRFQQPVPDVDPTAVNHYNASAPIEVASPFDNVTQGLVGSDAQALAEYWQKTIDTLEHDDQAVKTLHLPLARIKKVMKTDDDVKNKMISAEAPFLFAKGSEIFIAELTMRAWLHAKKNQRRTLQRSDIANAVSKSEMYDFLIDIISKDNNNSRASSSQAHMSATQVAAMGGMNGLQPFPTQAGLPNQGFPMPTGSQLPFSNQQSSQPSMQYSSHPSRMQQMQDIDQSMYKQQRLGSEYPQLQMSDNSGNVNQMNMQRPVMVAPYMAEHLYRYPPTHLESGSSAFRLQSSPMGYQMPQFQGNMRPNMQQSQMFDPSAYGMSRRPGSPRQFDQQQRLYSQPNAMMYQTQQGRQGNPMHQQFSQQQNPLSRYSQQPQ

HAP5

Transcriptional activator HAP5

242 amino acids

Acts a component of the CCAT-binding factor, which is a transcriptional activator and binds to the upstream activation site (UAS2) of the CYC1 gene and other genes involved in mitochondrial electron transport and activates their expression. Recognizes the sequence 5'-CCAAT-3'. HAP5 is essential for DNA-binding activity. It may be the linchpin that binds to the subunit association domains (SAD) of HAP2 and HAP3 to bring these proteins together.

Belongs to the NFYC/HAP5 subunit family.

27.676 kDa

MTDRNFSPQQGQGPQESLPEGPQPSTMIQREEMNMPRQYSEQQQLQENEGEGENTRLPVSEEEFRMVQELQAIQAGHDQANLPPSGRGSLEGEDNGNSDGADGEMDEDDEEYDVFRNVGQGLVGHYKEIMIRYWQELINEIESTNEPGSEHQDDFKSHSLPFARIRKVMKTDEDVKMISAEAPIIFAKACEIFITELTMRAWCVAERNKRRTLQKADIAEALQKSDMFDFLIDVVPRRPLPQ