GRX3

Monothiol glutaredoxin-3

250 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Binds one iron-sulfur cluster per dimer. The iron-sulfur cluster is bound between subunits, and is complexed by a bound glutathione and a cysteine residue from each subunit (Probable).

Belongs to the glutaredoxin family. Monothiol subfamily.

28.261 kDa

MPVIEINDQEQFTYLTTTAAGDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLEDCKNSVNSGSSQTHTMENANVNEGSHNDEDDDDEEEEEETEEQINARLTKLVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVRQNLKKFSEWPTFPQLYINGEFQGGLDIIKESLEEDPDFLQHALQS

grx3

Monothiol glutaredoxin-3

166 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Binds one iron-sulfur cluster per dimer. The iron-sulfur cluster is bound between subunits, and is complexed by a bound glutathione and a cysteine residue from each subunit (By similarity).

Belongs to the glutaredoxin family. Monothiol subfamily.

18.314 kDa

MANRKIFLITSLIISLLLIHIFIFSPLNEPEKNAKAGPLGLSDVSVPSAPKLPAKDSTDFEVFLENPVIIFSRPGCPYSAAAKKLLTETLRLDPPAVVVEVTDYEHTQELRDWLSSISDISTMPNIFVGGHSIGGSDSVRALYQEEKLQSTLDEWTHNKVLILPTD