GLRX5

Glutaredoxin-related protein 5, mitochondrial

157 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (PubMed:20364084). Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase (PubMed:24334290). Required for normal iron homeostasis. Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1 (PubMed:20364084). May protect cells against apoptosis due to reactive oxygen species and oxidative stress (By similarity).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.628 kDa

MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK

GLRX5

Glutaredoxin-related protein 5, mitochondrial

157 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (PubMed:20364084). Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase (PubMed:24334290). Required for normal iron homeostasis. Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1 (PubMed:20364084). May protect cells against apoptosis due to reactive oxygen species and oxidative stress (By similarity).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.628 kDa

MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK

glrx5

Glutaredoxin-related protein 5, mitochondrial

155 amino acids

Monothiol glutaredoxin involved in iron-sulfur biogenesis. Required for normal iron homeostasis. Required for normal hemoglobin biosynthesis.

17.377 kDa

MNSVFRSTARCLRSATWQYKTAHKNGELSVGRARLMCSSAGQKNLEEMVKKDKVVVFMKGTPAQPMCGFSNAVVQILRMHGVDNYASYNVLDDQDVRQGIKTFSNWPTIPQVFFNGEFVGGCDILLQMHQSGDLVEELQKLGIRSALLDQEKESK

glrx5

Glutaredoxin-related protein 5, mitochondrial

155 amino acids

Monothiol glutaredoxin involved in iron-sulfur biogenesis. Required for normal iron homeostasis. Required for normal hemoglobin biosynthesis.

17.377 kDa

MNSVFRSTARCLRSATWQYKTAHKNGELSVGRARLMCSSAGQKNLEEMVKKDKVVVFMKGTPAQPMCGFSNAVVQILRMHGVDNYASYNVLDDQDVRQGIKTFSNWPTIPQVFFNGEFVGGCDILLQMHQSGDLVEELQKLGIRSALLDQEKESK

Glrx5

Glutaredoxin-related protein 5, mitochondrial

152 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase (By similarity). Required for normal iron homeostasis (By similarity). Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1 (By similarity). May protect cells against apoptosis due to reactive oxygen species and oxidative stress (PubMed:19442627).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.292 kDa

MSASLSRAAAALLRWGRSAGGGGLPGAGVRAASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALVDEKDQDSK

Glrx5

Glutaredoxin-related protein 5, mitochondrial

152 amino acids

Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase (By similarity). Required for normal iron homeostasis (By similarity). Required for normal regulation of hemoglobin synthesis by the iron-sulfur protein ACO1 (By similarity). May protect cells against apoptosis due to reactive oxygen species and oxidative stress (PubMed:19442627).

Belongs to the glutaredoxin family. Monothiol subfamily.

16.292 kDa

MSASLSRAAAALLRWGRSAGGGGLPGAGVRAASSGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALVDEKDQDSK