Function
Plays a role in osmotic stress responses by regulating ion homeostasis and by controlling cell volume via the phosphorylation-mediated inhibition of the chloride channel clh-3 (PubMed:15684092, PubMed:17596296). In addition, increases gpdh-1 translation upon osmotic stress, likely downstream of wnk-1 (PubMed:23076791). Involved in several developmental processes including the tubular formation of the excretory canals, the formation of the intestine and the progression through larval stages (PubMed:20595048). In addition, required for germ line development by controlling meiosis and chromosomal segregation during spermatogenesis. By controlling clh-3 activity, may regulate the development of the excretory canals and fertility (PubMed:18049475).
Sequence
MSSSNLAGNTNTTTTSSAASAAAAHSAANASTITSEYSTTQTTTGTFNTDTLSSIGSTSTLHGSQPSQPPPPPPPQVSSPIAAAAAASAALVAQLNPADRWPTEPSAYKLDESIGVGATATVFTAYCLPRNEKVAIKCINLEKCQTSVDELSHEIQAMSQCNHPNVVSYYTSFIAQEELWVVMRLLNCGSMLDILKRKVKAIGKEQAQFGVLDEVSIATVLREVLKGLEYFHLNGQIHRDIKAGNILLADDGTIQIADFGVSGWLASSGGDLSRQKVRHTFVGTPCWMAPEVMEQVQGYDFKADIWSLGILAIELATGTAPYHKYPPMKVLMLTLQNDPPTLETNAERKDQYKAYGKSFKTLIRDCLQKDPAKRPTASELLKYSFFKKGKDKKYLVHTLIENLASVPVVAHHSSKKVASGKLRKDAHGNWEFEYDSPQESDDDSDLEDEEREKKKKKASASASGAGAAGAAGGATGGAASGAPSAQEGGGATTPCPETLNMVLRVRNQQRELNDIKFDYTKSADTVEGIAHELVTAELIDCHDLVIVAANLQKLIDFAESKSDRRSITFALNSGVHANEIPDERTLTGFAQISLLD