gatC

PTS system galactitol-specific EIIC component

451 amino acids

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II complex composed of GatA, GatB and GatC is involved in galactitol transport.

48.365 kDa

MFSEVMRYILDLGPTVMLPIVIIIFSKILGMKAGDCFKAGLHIGIGFVGIGLVIGLMLDSIGPAAKAMAENFDLNLHVVDVGWPGSSPMTWASQIALVAIPIAILVNVAMLLTRMTRVVNVDIWNIWHMTFTGALLHLATGSWMIGMAGVVIHAAFVYKLGDWFARDTRNFFELEGIAIPHGTSAYMGPIAVLVDAIIEKIPGVNRIKFSADDIQRKFGPFGEPVTVGFVMGLIIGILAGYDVKGVLQLAVKTAAVMLLMPRVIKPIMDGLTPIAKQARSRLQAKFGGQEFLIGLDPALLLGHTAVVSASLIFIPLTILIAVCVPGNQVLPFGDLATIGFFVAMAVAVHRGNLFRTLISGVIIMSITLWIATQTIGLHTQLAANAGALKAGGMVASMDQGGSPITWLLIQVFSPQNIPGFIIIGAIYLTGIFMTWRRARGFIKQEKVVLAE

gatC

PTS system galactitol-specific EIIC component

451 amino acids

The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The enzyme II complex composed of GatA, GatB and GatC is involved in galactitol transport.

48.365 kDa

MFSEVMRYILDLGPTVMLPIVIIIFSKILGMKAGDCFKAGLHIGIGFVGIGLVIGLMLDSIGPAAKAMAENFDLNLHVVDVGWPGSSPMTWASQIALVAIPIAILVNVAMLLTRMTRVVNVDIWNIWHMTFTGALLHLATGSWMIGMAGVVIHAAFVYKLGDWFARDTRNFFELEGIAIPHGTSAYMGPIAVLVDAIIEKIPGVNRIKFSADDIQRKFGPFGEPVTVGFVMGLIIGILAGYDVKGVLQLAVKTAAVMLLMPRVIKPIMDGLTPIAKQARSRLQAKFGGQEFLIGLDPALLLGHTAVVSASLIFIPLTILIAVCVPGNQVLPFGDLATIGFFVAMAVAVHRGNLFRTLISGVIIMSITLWIATQTIGLHTQLAANAGALKAGGMVASMDQGGSPITWLLIQVFSPQNIPGFIIIGAIYLTGIFMTWRRARGFIKQEKVVLAE

gatc

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

194 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

22.004 kDa

MYVVVNYTRRLQTLAFNLGSSCYHQGVTGASITSQDRKSKQNFSCCRWTHLITLVHQYSTRISNSKVPRVATWEPVLENQLPPPCQIPVDLVDKLERLALVDFRNQEGLACLEKAIRFADQLHVVDTDGVDPMDSVLEERALYLREDAVAEGDCAEELLQLSKNTVEEYFVAPPGNIPLPKREERAAMLKHSEF

gatc

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

188 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

21.152 kDa

MSVLRFATRRGLSWCYASRLTHQGTSVTSGEGSPGTRTSRVPARVLNLTRPLSCRAYNSKVPQSPTWEPVSEDLLPPCAQFPADLVDKLERLALVDFRTKQGLECLEKAIRFADQLHVVDTSGVEPMDSVLEDRVLYLREDEEKEGDCAEELLQLSRNTCEEYYVAPPGNIPLPTREKRAAMLKHSEF

gatc

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

184 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

20.456 kDa

MLCKCAAGALRALRPATPRIGVLNLTALSASLSANRTSWSRWTHMRDSSNAAWTPKVPQTPTWEPVAESQLPPATRISPDLVDKLERLALVDFGSEEGVDCLEKAIRFADQLHVINTDGVEPMDSVLEDRELYLRDDTVTEGECAEELLQLAKHTVEEYFLAPPGNIPLPKREERSAMLKDSEF

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

181 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

20.336 kDa

MIFLGPVLLTRGALSFFLTAGGSSVYRAWSWWLSGIHLFMAFSMSTSSLYKVGFGFVCTKSPCLRVSLISRSQPWRFYSVHNNFEAPDVVQLAAKARISLTPKEVEDYGPKIGQVIDWFGQLQGVNLENVEPAIRADTDKLSNLRPDEPIIYEDREEMIAGVPTLEEPFIKVPKILKSSME

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

155 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

17.519 kDa

MATRALLAVIYASPNRCYISPSRIKIQSLTCSSSSHYYQRQSRKNHRIARSYSSDSDSSVLQPPDVARLAQTARISLTPAEIEECETKIRRVIDWFGQLQQVDVNSVEPAIRAEMDGGNLREDAPETFDNRDSIRASIPSFEDAYLKVPKILNKE

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

155 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

17.519 kDa

MATRALLAVIYASPNRCYISPSRIKIQSLTCSSSSHYYQRQSRKNHRIARSYSSDSDSSVLQPPDVARLAQTARISLTPAEIEECETKIRRVIDWFGQLQQVDVNSVEPAIRAEMDGGNLREDAPETFDNRDSIRASIPSFEDAYLKVPKILNKE

Gatc

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

155 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.833 kDa

MWAQAARVQFRAPLDRGRSFASKVGPRGKVQAADPKTQAPRLVPEGTDRVSAAVVEHLERLALVNFSSREAVDRLEKAVAFADQLHAVDTDGVEPLESVLEDRCLYLRSDKVAEGGCAEELLQNSNHVVEEYFVAPPGNIPLPDMVGKVPSSTAE

Gatc

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

155 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.667 kDa

MWSRAASVRFRAPLDAGRSFASKANPQGKVQAAGLGTQAPRLVPQGSGRVSPAVIEHLERLALVNFGSREAVDRLEKAIAFADQLHAVDTDGVEPLESVLEDRCLYLRSDNVAEGSCAEELLQNSNHVVEEYFVAPPGNISLPDMVNKIPSSTAE

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

155 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

17.525 kDa

MWARAVRFGLRSWVAWRRGFTSKADPQVAKQVRTRYPHSPPHSPQGNGRVSAQVIEHLERLALVDFGSQEAVARLEKAIAFADRLRAVDTGGVEPMESVLEDRCLYLRSDNVVEGNCAEELLQNAHRVVEEYFVAPPGNISLPKQDEQEPFSYNH

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

153 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.61 kDa

MLSAAASAIPRLRWAAPPRNQSARNQWLLLRRRSLSSSPPYVTPGIPAAAAAAGSGALEPPDLPRLANAARISLSPEEAEEFAPKIRQVVDWFGQLQAVDLESVEPSLRAGTAAGNSLREDRPETFTNRDAIIESVPSYDDPYIKVPRVLNKE

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

153 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.61 kDa

MLSAAASAIPRLRWAAPPRNQSARNQWLLLRRRSLSSSPPYVTPGIPAAAAAAGSGALEPPDLPRLANAARISLSPEEAEEFAPKIRQVVDWFGQLQAVDLESVEPSLRAGTAAGNSLREDRPETFTNRDAIIESVPSYDDPYIKVPRVLNKE

GatC

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

148 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.869 kDa

MLRLFSSRFYCKIATKSNEKATKLDFKQLTHPTKVPQTPVDSKFPDTSASEIQIDTKTIQLLERLSLVDLDSERALATLKSSIQFADKIAHINTEHVRPLYTVLEHQQLQLRNDQVTEGDCRAEVLRNAKVTDEDYFVSPPGNIPLEQ

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

146 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.02 kDa

MLSAAAAAAVIPKLRFATRPQLRRPAARTYWPRPLSSSSHVTPAAAGAGELEPPDLTRLANAARISLSPQEAEDFEPKIRQVVDWFGQLQAVDLESIEPSLRAGTTADSSLREDKPETFDNRDAIVEAIPSYDDPYIKVPRVLNKE

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

143 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.013 kDa

MGSRALLLLKVALPLKHQIKCLNYTKITPASELLTKRRFSIKATNGSSLQPPDVSRLAETARISLNQNEVEEFAPKIRQVIDWFGQLQAVDLNSVEPAIRADSEGENLRDDVPETFSEREAIIAAVPSYEKPYVKVPKVLNKE

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

143 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

16.013 kDa

MGSRALLLLKVALPLKHQIKCLNYTKITPASELLTKRRFSIKATNGSSLQPPDVSRLAETARISLNQNEVEEFAPKIRQVIDWFGQLQAVDLNSVEPAIRADSEGENLRDDVPETFSEREAIIAAVPSYEKPYVKVPKVLNKE

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

141 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

15.64 kDa

MGSRAVLLLKGPSPPKHSILFLLNHKKISPAPSIRRFTTKATANGSSLEPPDVARLAETARISLTPQQVEEFGPKIRQVIDWHALLSVDLDSVEPSIRADTEGDNLRHDNPETFENREAIIAAVPNYEDPYVKVPKVLNKE

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial

137 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in chloroplasts and mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

15.328 kDa

MGSRALLLLKATTAETLLFTSKSTFSKALIRNSTRSFSTRSALLPPDLPRLAETARISLTPHEVEEFAPKIRQVIDWFGQLQAVDLQSIEPSIRADTEGDNLRDDSPETFENREAIIAAIPSYEEPYLKVPKVLNKD

GATC

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

136 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

15.176 kDa

MWARAVHLGLRAAARGRRGFTSKADPQGSGRVTGELIQHLERLSLVDFGSQEAVARLEKAIAFADRLRAVNTDGVEPMESVLEDRCLYLRSDNVVEGSCAEELLQNSHRVVEEYFVAPPGNISWSKLDEKQPFSHR

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

114 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

12.559 kDa

MAQQRITSDIFAQLLTLSHLESSECAVGLATQIEDIIQYFSVVEQFDPGPRDDPDTDNAQGRCSQGNKIDVDCCPDWVRKDVALPGLSVHDLKRLSTEFADGYFRAPRALDGSA

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

104 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.616 kDa

MLDQSQVQKIAHLARLEITPEEESQFASQLSSILDYFDQLNELPTEGVEPTTRAIELSNIVRGDRQISWDGDNAATTRQALLDNAPEPEGDFFRVPRIMGGDEA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

102 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.277 kDa

MALNQQDVARIARLARIELTPEQQSRAQDELNGILHLIERLQAVDTQGVEPLAHPLSAHEDIPLRLRQDAVTETASAERRAELLANAPEQSAGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

102 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.168 kDa

MALNEQDVARIARLARIELTPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHEDITLRLREDAVSEQATEASRAELLANAPESADGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

102 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.19 kDa

MALNEQDVARIARLALIELPPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHEDITLRLREDAVSEQATEARRAELLANAPESADGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

102 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.319 kDa

MALNEQDVARIARLARIELTPDQRSRAQDELNGILHLIERLQAADTEGVEPLAHPLSAHQDIALRLRPDAVTETPSEDRRAELLANAPDARDGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

102 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.71 kDa

MSAISRDEVAHLARLARLALTDAELDGYAGQLDAILGHVSQISAVSTDELDEVDATSSPLDAVNVTRPDVIAECLTPEEALAAAPRVAEGRFAVPQILGEEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

102 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.145 kDa

MSETTISKEEVAHVAKLAKLSFDDSELTQFTTQLGDILNIFNTLGEVDTAAVEPTYSVTENVNHLRDDVAHNWHQKQGLLENAPLASAGLIKVPAILEDEGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

102 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.237 kDa

MALNEQDVARIARLARIELTPDQRGRAQAELNGILHLIERLQAVDTQGVEPLAHPLSAHEDITLRLREDAVSEQATEARRAELLANAPESADGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

101 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.216 kDa

MAITEEQVKHVAKLSKLSFSEEELADFTNQLDKIIDMVELLEEVDTTGVPFTSNVNESINVMREDVATPGMDRKELMRNVPESENGYIKVPAIMDNGEAGA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

101 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.708 kDa

MAAISREEVAHLARLSRLAVTEEELGTLAGQLDVILQAVAQVGEVTAADIPPTSHSVPLTNVLRDDVVAPCLSPQEALSGAPDAEEQRFRVPRILDEDVAS

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

101 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.713 kDa

MAAISREEVAHLARLSRLAVTEEELDTLAGQLDVILQAVAQVGEVTAADIPPTSHSVPLTNVLRDDVVASCLTPEEALSGAPDAAEQRFRVPRILDEDVAS

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

101 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.353 kDa

MEQFHLDREEILLLAKASALQLSEELIQEYQTSLSAVITSMKEALAIEIDDADSCESLFMHVVNVEDLREDSVTSDFNREEFLRNVPESLGGLVKVPAVIK

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.816 kDa

MSVDKETVAKIASLARIKMTDAELEKMAPELSNILDWVEQLGEVDTSDVEPMTAVIPNTLRLREDEVNADPLTGGGVRDKVLANAPAAEHGFFGVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.539 kDa

MAIDQATVRKIASLARIAISDAEAAAMEGELNGILGWVEQLGEVDVSGVEPMTAVIPNTLRLRDDVVDADPLTGGNRRDDILANAPAAMHGFFGVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.268 kDa

MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.268 kDa

MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.268 kDa

MTKVTREEVEHIANLARLQISPEETEEMANTLESILDFAKQNDSADTEGVEPTYHVLDLQNVLREDKAIKGIPQELALKNAKETEDGQFKVPTIMNEEDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.926 kDa

MSLALSDVKRLSMLAQIDLTDAQSAQTLDKLNGIFALVEQLSAVDTTGVEPLNHPIAALLPDLSLRLRDDVVSEPNRRDDYQQVAPATQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.385 kDa

MITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSTQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.302 kDa

MITKEEARKIAKLARLKFEKDTVEKFSTQLGTIMDMIDILNEIDCKDIEPLTSVSNMNARMREDAVTSSDLSNKLFDNVSGNSAQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.526 kDa

MITKEEVKKITKLARLKFEEDKVEEFSSRLSSIMDMINILNEIDCTDVKPLTSVCDMQARMRPDEVTSKDHSNELFDNVQGASQQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.497 kDa

MITKEEVKKIAKLARLKFEEDKVEEFSSRLSSIMDMIDILNEIDCTDVKPLTSVCDMQARMRPDEVTSKDHSNELFDNVQGASQQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.366 kDa

MITKEEAQKIAKLARLKFEEDTVEKFSTQLSSIMNMIDILNEIDCKDIEPLTSVSNMNARMREDEVTSSDLSDKLLDHVSGQSAQLAKEVKYFITPKVIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.321 kDa

MITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELLDNVSGNSAQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.344 kDa

MITKEEAQKIAKLARLKFEEDTVEKFSAQLSTIMNMIDILNEIDCKDIEPLTSVSNMNVRMREDVVTSSDLSNKLFDNVSGNSAQLAKEVKYFITPKVIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.344 kDa

MITKEEAQKIAKLARLKFEKDIVEKFSTQLSTIMNMINILNEIDCKDIEPLTSVSNMNARMREDTVTSSDLSNKLFDNVSGNSAKLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.369 kDa

MITKEEAQKIAKLARLKFEEDTIEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSAQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.327 kDa

MITKEAAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSTQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.327 kDa

MITKEAAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSTQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.372 kDa

MITKEEAQKIAKLARLKFEKDIVEKFSTQLSTIMNMINILNEIDCKDIEPLTSVSNMNARMREDTVTSSDLSNKLFDNVSGNSARLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.926 kDa

MSLALSDVKRLSMLAQIDLTDAQSAQTLDKLNGIFALVEQLSAVDTTGVEPLNHPIAALLPDLSLRLRDDVVSEPNRRDDYQQVAPATQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.385 kDa

MITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSTQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.302 kDa

MITKEEARKIAKLARLKFEKDTVEKFSTQLGTIMDMIDILNEIDCKDIEPLTSVSNMNARMREDAVTSSDLSNKLFDNVSGNSAQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.526 kDa

MITKEEVKKITKLARLKFEEDKVEEFSSRLSSIMDMINILNEIDCTDVKPLTSVCDMQARMRPDEVTSKDHSNELFDNVQGASQQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.497 kDa

MITKEEVKKIAKLARLKFEEDKVEEFSSRLSSIMDMIDILNEIDCTDVKPLTSVCDMQARMRPDEVTSKDHSNELFDNVQGASQQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.366 kDa

MITKEEAQKIAKLARLKFEEDTVEKFSTQLSSIMNMIDILNEIDCKDIEPLTSVSNMNARMREDEVTSSDLSDKLLDHVSGQSAQLAKEVKYFITPKVIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.321 kDa

MITKEEAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELLDNVSGNSAQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.344 kDa

MITKEEAQKIAKLARLKFEEDTVEKFSAQLSTIMNMIDILNEIDCKDIEPLTSVSNMNVRMREDVVTSSDLSNKLFDNVSGNSAQLAKEVKYFITPKVIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.344 kDa

MITKEEAQKIAKLARLKFEKDIVEKFSTQLSTIMNMINILNEIDCKDIEPLTSVSNMNARMREDTVTSSDLSNKLFDNVSGNSAKLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.369 kDa

MITKEEAQKIAKLARLKFEEDTIEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSAQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.327 kDa

MITKEAAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSTQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.327 kDa

MITKEAAQKIAKLARLKFEEDTVEKFFTQLSTIMDMIDILNEIDCKDIEPLTSVCNMNARMREDAVTSSDLSSELFDNVSGNSTQLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.372 kDa

MITKEEAQKIAKLARLKFEKDIVEKFSTQLSTIMNMINILNEIDCKDIEPLTSVSNMNARMREDTVTSSDLSNKLFDNVSGNSARLAKEVKYFITPKVVE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.805 kDa

MSDISRDEVAHLAKLSRLALSEEELKQFAAQIDEIVDSVSAVGKVEAEGVEPMSHPHSVHAPMREDVVVRTLTAEQALDQAPAADDDRFMVPQILGGGDE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

12.02 kDa

MERRDFKEQLKKTAHLARLHLTPEEEELFAKQLQNILDYFKKLQELDTSNVEPMAHVLPLYNIWREDEVRESISQEEALKNAPEIEDLGFKIPRIMKREE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.862 kDa

MEKRDFKEQLKKTAHLARLYLTPEEEELYAKQLQDILDYFKKLQEVDTSNIEPMAHVLSLSNIWREDEPKGSISQEEAFKNAPEIENLGFKIPRIIKREE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.044 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.939 kDa

MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEVDTTGVAVTTTMADRKNVLRADIAQKGESREELFKNVPESQDNFIKVPAILDGGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.057 kDa

MKISEEEVRHVAALSKLSFSESETIEFATTLSKIVDMVELLNEVDTTGVAITTTMADKKNIMRADIAETGVDRKFLFQNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.142 kDa

MKITQEEVSHVAKLSKLAFSPEETAEFATTLTKIVDMVELLNEVDTEGVPFTSNVAANINYMREDVAQPGWNREELFQNVPEKERGYIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.939 kDa

MKISEAEVRHVAKLSKLEFSDQETAEFATSLSKIVDMVELLNEVDTTGVAVTTTMADRKNVLRADIAQKGESREELFKNVPESQDNFIKVPAILDGGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.128 kDa

MKITQEEVTHVANLSKLKFSPEETAEFATTLSKIVDMVELLEEVDTTGVAPTTTMADRKTVLRPDVAEKGTDRDRLFKNVPEKDNYYIKVPAILEDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.098 kDa

MKISEEEVRHVATLSKLAFSEEETSQFATTLTKIVDMVELLNEVDTEGVAITTTMADRKNVMRPDLAQAGTNREDLFKNVPEKENNFIKVPAILEDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.044 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.043 kDa

MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.055 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGIDRDRLFKNVPEKDNYYIKVPAILDNGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.98 kDa

MKISEEEVRHVAALSKLSFSESETTEFATTLSKIVDMVELLNEVDTTGVAITTTMADKKNIMRADIAEAGVDRKLLFQNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.029 kDa

MKISEEEVRHVAALSKLSFSESETTEFATTLSKIVDMVELLNEVDTTGIAITTTMADKKNIMRADIAEAGVDRKFLFQNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.127 kDa

MKITQEEVSHVAKLSKLAFSPEETAEFATTLSKIVDMVELLNEVDTEGVPFTSNVAANINYMREDVAQPGWNREELFQNVPEKERGYIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.21 kDa

MKISEEEVRHVANLSKLKFSDDETTEFATTLTKIVDMVELLNEVDTQGVPFTSNVADNINYMREDVSVAGWDREQLFKNVPEHEDGLIKVPAIIDEGGDA

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.07 kDa

MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.044 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.07 kDa

MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.043 kDa

MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPKKDNYYIKVPAILDDGGDA

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.07 kDa

MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.044 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.088 kDa

MKISEEEVRHVAKLSKLSFSESETTAFATTLSKIVDMVELLNEVDTEGVAITTTMADKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILYDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.07 kDa

MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.072 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVVEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.044 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPEQDNYYIKVPAILDDGGDA

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.055 kDa

MKITQEEVTHVANLSKLRFSEEETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGIDRDRLFKNVPEKDNYYIKVPAILDNGGDA

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.07 kDa

MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.084 kDa

MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVDTEGVAITTTMADKKNVMRQDIAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.074 kDa

MTESYVNKEEIISLAKNAALELEDAHVEEFVTSMNDVIALMQEVIAIDISDIILEATVHHFVGPEDLREDMVTSDFTQEEFLSNVPVSLGGLVKVPTVIK

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.074 kDa

MTESYVNKEEIISLAKNAALELEDAHVEEFVTSMNDVIALMQEVIAIDISDIILEATVHHFVGPEDLREDMVTSDFTQEEFLSNVPVSLGGLVKVPTVIK

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.074 kDa

MTESYVNKEEIISLAKNAALELEDAHVEEFVTSMNDVIALMQEVIAIDISDIILEATVHHFVGPEDLREDMVTSDFTQEEFLSNVPVSLGGLVKVPTVIK

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.074 kDa

MTESYVNKEEIISLAKNAALELEDAHVEEFVTSMNDVIALMQEVIAIDISDIILEATVHHFVGPEDLREDMVTSDFTQEEFLSNVPVSLGGLVKVPTVIK

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.549 kDa

MSVDTATVAKIASLARIKVSEAELGAMVPELNGILAWVEQLGEVDVTGIEPMTAVIPNKQRLRDDVVNADPLTGGDMRDAVLANAPAPEHGFFGVPKVIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

11.084 kDa

MTQSYVNKEEIISLAKNAALELEEAHVEEFVTSMNNVIALMQEVVAIDISDIILEATVHHFVGPEDLREDMVTSDFTREEFLANVPVSLGGLVKVPTVIK

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

100 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.588 kDa

MEINTELIKKLKKLSNIELSPSEEERIKKDLNALLEYQKILDKIDVEGIEEMVSPIEFSTSILRKDEVESFESRKKIINNFPENKDGFLAVPGIHVNEEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.666 kDa

MPTFSREEIVHLGDLARIALTDEEITRLQGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETPLTQEEALAGGPKTEAGMFVAPRILGSEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.85 kDa

MKITEKEVRYVAGLANLNLTEQEIARMQVDLDGILEHMARLNEIDTEGVAPMSQVLFEAEETATLRPDSPIPPLGNQAAMANAPQSGAGYFKVPKVIER

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.912 kDa

MALTPQDIGRIANLARLELSPGESERMLTQLNGFFGIVEKMQAVDTHGIAPLSHPVAVVRDVQLRLREDVASEPDQREANQRSAPAVERGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.912 kDa

MALTPQDIGRIANLARLELSPGESERMLTQLNGFFGIVEKMQAVDTHGIAPLSHPVAVVRDVQLRLREDVASEPDQREANQRSAPAVERGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.941 kDa

MPEISRDEVAHLAKLSRLALTDEELDRFAEQIDGIIGNVSAVQQVAAEGVEPMSHPHSIKTTMREDVVEQILTPEQALDQAPAVDQQRFVVPQILGEQD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.772 kDa

MPEISRDQVAHLAKLARLALSEEELQQFAGQIDDIVGHVSAVQNVDAEGVEPMSHPHSIMTTMRDDVVVKTLTPEQALDQAPAVEDGRFMVPQILGEGD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.636 kDa

MPEISRDQVAHLAKLSRLALTEEELEQFAGQIDDIVGYVSAVQNVDAAGVEPMSHPHSIATTMREDVVHKTLDAAAALDQAPAVEDGRFMVPQILGEGD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.636 kDa

MPEISRDQVAHLAKLSRLALTEEELEQFAGQIDDIVGYVSAVQNVDAAGVEPMSHPHSIATTMREDVVHKTLDAAAALDQAPAVEDGRFMVPQILGEGD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.972 kDa

MALALSDVKRIAHLARIETSDAEAEQTLAQLNNFFSLVEQMQAVDTTGIEPLAHPLSAVRDIAQRLREDAVTESDRRADYQRPAPATENGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.031 kDa

MALALSDVKRIAHLARIEISDDEAAQTLAQLNNFFSLVEQMQAVDTSGIEPLAHPLSAVRDMVQRLREDVVTESDRRADYQRPAPATEDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.105 kDa

MALDLSDVKRIAHLARIETSDDEAAQTLAQLNNFFSLVEQMQAVDTTGIEPQAHPLSAVRDMVQRLREDVVTETDRRADYQRPAPATENGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.979 kDa

MALELSDVKRIAHLARIEVSEGEAAQTLTQLNQFFSLVEQMQAVDTTGIEPMAHPIEQVQAQAQRLRDDAVTEADRRADYQQCAPATEAGLYLVPKVIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.004 kDa

MALELSDVKRIAHLARIEVSDGEAAQTLTQLNQFFTLVEQMQAVDTTGIEPMAHPIEQVQAPAQRLREDAVTEPDRRADYQQCAPSTEAGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.449 kDa

MPAISRDEVAHLARLSRLALSDAELDEFAGQLDSILNHVKVVTEVAADDVPPMANPNAVTNVTRPDVIVPGLTPEQALSGAPAVEQDRFAVPQILGEGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.049 kDa

MSLTSTDIARIANLARLELKAAESERMLTQINGFFALVEKMRAVDTTGIEPLAHPVATVQDITLRLREDRVSEPNQREANQRNAPALEHGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.446 kDa

MPAISRDEVAHLARLSRLALTDAELDEFAGQLDSILSHVKVVTEVPAEDVPPMANPNAVTNVTRPDVIVPGLTPEQALSGAPAVEQGRFVVPQILGEGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.476 kDa

MPAISRDEVAHLARLSRLALTDAELDEFAGQLDSILSHVKVVTEVPAEDVPPMANPNAVTNVTRPDVIVPGLTPEQALSGAPAVEQDRFAVPQILGEGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.827 kDa

MALNAQDIARIANLARLELSSTESERMLGQLNDFFGIVEKMQAVDTSGVSPLSHPVAAIQDIALRLREDIASEPDQRDANQRSAPAVERGLFLVPKVIE

gatc

Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial

99 amino acids

Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.226 kDa

MLSIPEDKVEQYCDDLGGFLNSVESIQSVNTENVRPLHSILEDTQLTLHFEQTTVNQDHEHILDHSNNVQGGFFTVPKQISSHTNSQKSNKNNSIDDEF

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.957 kDa

MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLRDDAVTEVVDRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.956 kDa

MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.936 kDa

MALTLTDVKRIAHLARLEMADADAEHMLGQLNELFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLREDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.03 kDa

MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.03 kDa

MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.03 kDa

MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.03 kDa

MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.03 kDa

MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.03 kDa

MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.03 kDa

MALTLTDVTRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLREDAVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.071 kDa

MALTLTDVKRIAHLARLEMADADAERTLTQLNEFFGLVEQMQAVDTTGIAPLAHPIEQILEVAQRLRDDVVTEHVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.926 kDa

MALTLTDVKRIAHLARLEMADADAEHTLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.783 kDa

MALTPTDVSRIALLARLELSEAEQSAMLSQLNGFFDIVERMRAVDTTGVAPLYTPLSAVQEVALRLREDAVTEVDQRQANQLSAPAVEAGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.357 kDa

MTNQIEKELIEKVAKLSNLKLKEEEIELFSNQFKDILSFIDKLNEVDVKDTLPFYELQIEEKSEREDIPTGSITNEEAIKNAPQAKGGFFVVPRVVGEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.71 kDa

MALTPADVSRIANLARLELSTAEQSDLLVQLNGFFGIVERMRAVDTTGVAPLYTPLSAVQDVSLRLRDDAVTETDQREANQKSAPAVEGGLFLVPRVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.986 kDa

MSKITNEQVKHVAHLARLEITEEEATKFSAQLEAILNFADQLEEVDTEGVEPTFHVLDLQNVLREDVAETSLTQEEILKNAAHTEDGQFKVPSILGGGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.397 kDa

MPAISRDEVAHLARLSRLALSDAELDQFAGQLDSILSHVRTISEVAAADVPATASPDPVTNVTRPDTVVPGLTPDQALAAAPAVEEQRFMVPQILGEGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.541 kDa

MISINEVQSIANYCKLRFNEQELNHMVKQLSSIVEMMNKLEKIDCTSVPPMRHFEENNRMRKDQVEQNITVDQLLSNVPQSSATIAKNTKYFVVPKIIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.048 kDa

MALTLTDVKRIAHLARLELPDADAEHTLIQLNDFFGLVEQMQAVDTTGISPLAHPIEQIEDVALRLRNDAVTENVNRDDYQRSAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.972 kDa

MALTLTDVKRIAHLARLELADADAEHTLVQLNDFFGLVEQMQAVDTSGIAPLAHPIEQIEDVALRLRNDVVTETVEREAFQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.733 kDa

MSLSASDIARIASLARLQLASDESERMLSQINGFFDLVERMRSVDTAGVEPLAHPVAAVEDITLRLRDDVASEPDNREANQKSAPAVEAGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.003 kDa

MALTLTDVKRIAHLARLELADAEAEHTLVQLNDFFGLVEQMQAVDTTGIAPLAHPIEQIEDVALRLRDDTVTETVEREAFQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.875 kDa

MALTFKDIERVANLARLELRPDETEHTLSQLNGFFALVEQMQAVNTDGVEPLAHPAALLGEVALRLREDIASEPNQREASQASAPAVERGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.714 kDa

MALTSQDIARVANLARLELRPEETEHTLSQLNGFFALVEQMAAVNTDGVEPLAHPAAVIGEVALRLRDDIASEPNQREASQVSAPAVERGLFLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.956 kDa

MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.956 kDa

MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.956 kDa

MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.956 kDa

MALTLTDVKRIAHLARLEMADADAEHMLGQLNEFFGLVEQMQAVDTAGIAPLAHPIEQIQEVAQRLRDDAVTEVVNRDDNQRPAPAVQDGLYLVPKVIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

10.748 kDa

MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.748 kDa

MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.748 kDa

MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.882 kDa

MSPISRDEVLHLARLTRLVLTDTELASFSSQLDVILAHVSQIQAVDVTGVEPTDNPLKYVNITRPDETVPCLTQQQALAEAPEAIYGRFVVPQILGDNK

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

10.882 kDa

MSPISRDEVLHLARLTRLVLTDTELASFSSQLDVILAHVSQIQAVDVTGVEPTDNPLKYVNITRPDETVPCLTQQQALAEAPEAIYGRFVVPQILGDNK

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.556 kDa

MSQISRDEVAHLARLARLALTEDELDSFAGQLDAILTHVSQIQAVDVTGVEATDNPLKDVNVMRADQTAPCLTQEEALAEAPAAVDGRFAVPQILGDSE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.557 kDa

MSQISRDEVAHLARLARLALTEDELDGFAGQLDAILGHVSQIQSVDVTGVEPTDNPLKDVNVTRPDTVQPCLTQDEALAAAPKAADGRFAVPRILGEPE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.748 kDa

MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

10.748 kDa

MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

10.748 kDa

MSQISRDEVAHLARLARLALTETELDSFAGQLDAILTHVSQIQAVDVTGVQATDNPLKDVNVTRPDETVPCLTQRQVLDQAPDAVDGRFAVPQILGDEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.556 kDa

MSQISRDEVAHLARLARLALTEDELDSFAGQLDAILTHVSQIQAVDVTGVEATDNPLKDVNVMRADQTAPCLTQEEALAEAPAAVDGRFAVPQILGDSE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.507 kDa

MSQISRDEVAHLARLARLALTDSELDSFAGQLDAILGHVGQIQTVDVTGVEATGNPLKDVNVFRPDVEAPSLTQEQALAAAPNTDEGRFAVPRILGEAE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

99 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.6 kDa

MSAITRDEVAHLARLARLALPEDELDQLAAQLDVIISAVAKVQEVAKGDIPPTSHALPLTNVYRPDEVKPGLTPDQALAEAPAVEDGRFRVPQILGEEG

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.343 kDa

MSTFTTDEVARLANLARIDLTPAELERYAGELEVIASAVARVSEVAGDDVPATSHPIPLTNVWRDDVAAPTLDRGEVLASAPEAADGKFAVPQILGEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.512 kDa

MPTFTREEIVHLGDLARIALTDEEITRMQSELNVIADAIDSVQEVATADVEPTANPVPLEAYLRPDVPATPLTQAEALSGAPVAEDGMFVAPRILGEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.537 kDa

MPTFTKEEIVHLGDLARIALTDEEITRLQGDLNVIAESINKVQEVATDDVEPTANPVPLEAYLRPDVPETPLTQAEATAGAPVSEAGMFVAPRILGQE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.279 kDa

MLLTMEDVEHVARLARLRLSPDELEHMRDQLSKILDHFQMLQQIDVSAVPPTAQVTDLINVMREDEVRPSLPREQALANAPEQQDGMFRVRAIFEEAS

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.279 kDa

MLLTMEDVEHVARLARLRLSPDELEHMRDQLSKILDHFQMLQQIDVSAVPPTAQVTDLINVMREDEVRPSLPREQALANAPEQQDGMFRVRAIFEEAS

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.437 kDa

MLDRQQVQKIAHLARLDITSEEEEKFADQLSDILDYFEQLSELDTENVPPTTRAIELSNITRQDSFELYHDRDALLNEAPNPEGDFFRVPQILNTDEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.326 kDa

MIDTEQVKKIAHLARLEITPEQEEQFTGQLSSILEYFDQLSELDTTDVPPTTRAIEIKNITRSDSMQPYPSREELLKEAPEQEGDFFKVPQILNTDEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.324 kDa

MINRQQVEKIAHLARLEITPAEEEAFAPQLNSILQYFDQLSELDTENVPPMTRAIELSNITRSDRTETYGDRESLLKSAPEQEGDFFRVPQIMNNDQE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.457 kDa

MAEINRDDVAHLAQLAHIDMSESELDRMAGELAVIVDSVKSVSEIAGDDAPATSHPIPLSNVLREDTVGHVLSQEQVLSGAPDAEDGRFKVPAILEED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.408 kDa

MAAINRDDVAHLARLAHIEMSAQELDRMAGELAVIVDSVKSVSEAAGDDVPATSHPIPLTNVFREDVVGHTFSAEQALSGAPDSDDNRFKVPAILDEA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.185 kDa

MIDRATVEKIAHLARLEINSGEEEQFALQLSGILDYFEQLSELDTENVLPTTRAIEIQNITRADSNRLYPDHEVLVQESPAPEGDYFLVPRILNTDED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.72 kDa

MPEITRDQVEHLARLAHIRMTDEELDTMSGDLEKILEHVSAVQAAAGDDVTPTSHPIALENVFREDVPAGMLTQEEALDQAPDSEDGQFKVPAILDGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.506 kDa

MSQISRDEVAHLARLSRLALTDAELDSFAGQLDAILTHVSQVQAVDVTGVEPTDNPLKDLNVTRPDEPMPCLTQAEALAEAPEAVDGRFAVPQILGDE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.486 kDa

MAAINRDDVAHLARLAHIEMSAEELDRMAGELAVIVESVKSVSEAAGDDVPATSHPIPLTNVFREDVVGHTFTAEQSLSGAPDAYEGRFKVPAILDED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.699 kDa

MPGITREEVAHLARLARLELKAEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADEVRPSLTPEQALSGAPAQEQQRFKVPQILGED

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

10.779 kDa

MPGITREEVAHLARLARLELKPEELEHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRPDEVRPSLTPEQALSGAPAQEQQRFKVPQILGEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.627 kDa

MPGITREEVAHLARLARLELKGEELDHFAGQLDDIIGAVARVSEVADQDVPPTSHPLPLTNVMRADEVRPSLTPAQALSGAPAQEQQRFKVPQILGED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.585 kDa

MAAINRDDVAHLARLAHIEMSAEELDRMAVELAVIVDSVKSVSEAAGEDVPATSHPIPLTNVFREDVVGHTFTAEQALSGAPDSYENRFKVPAILDED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

98 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.506 kDa

MSQISRDEVAHLARLSRLALTDAELDSFAGQLDAILTHVSQVQAVDVTGVEPTDNPLKDLNVTRPDEPMPCLTQAEALAEAPEAVDGRFAVPQILGDE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.085 kDa

MALTLQDVEHVARLARLRLSPAELEKMRDQLSNILDHFQMLQQIDVSAVPPTAQVTDLVNVLREDEIRPSLPHEQALANAPEQQDGMFRVRAIFEEE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.306 kDa

MKIEVNENLIKHLENLSLIQLSGEEEKILEKDLANIIKFFEKINELDLSNVEPLFHPLPQGRLRKDVPRDPLDRENALKNVKRKEDGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.757 kDa

MSTPQIDVAYIAKLARIDLTEEETALFSKDLDKVLAYITKLESYDVTGIAPMNHPLPAMDVMREDIPETGFTQEEALSNAPQQSQGQFRTPKVVESA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.612 kDa

MALSLEEVRRIAVLARLRLSEEEERTFAGQLSAILDHVRQLEELDVTAVEPMTHALAAGELPARREDAVLPSLTPEEATAAAPAREGTAFKVPRIIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.585 kDa

MALSLEEVRRIAQLARLRLSEEEERTFAGQLSAILDHVRQLEELDVTAVEPMTHALAAGELPALREDAVRASLAPEEATAAAPAREGTAFKVPRIIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.646 kDa

MALSLEEVRRIAVLARLRLSEEEERTFAGQLSAILDHVRQLEELDVTAVEPMTHALAAGELPARREDAVFPSLTPEEATAAAPAREGTAFKVPRIIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.757 kDa

MSTPQIDVAYIAKLARIDLTEEETALFSKDLDKVLAYITKLESYDVTGIAPMNHPLPAMDVMREDIPETGFTQEEALSNAPQQSQGQFRTPKVVESA

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.612 kDa

MALSLEEVRRIAVLARLRLSEEEERTFAGQLSAILDHVRQLEELDVTAVEPMTHALAAGELPARREDAVLPSLTPEEATAAAPAREGTAFKVPRIIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.585 kDa

MALSLEEVRRIAQLARLRLSEEEERTFAGQLSAILDHVRQLEELDVTAVEPMTHALAAGELPALREDAVRASLAPEEATAAAPAREGTAFKVPRIIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.646 kDa

MALSLEEVRRIAVLARLRLSEEEERTFAGQLSAILDHVRQLEELDVTAVEPMTHALAAGELPARREDAVFPSLTPEEATAAAPAREGTAFKVPRIIE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.765 kDa

MSSISRDEVAHLARLSRLSLTDDELDEFADQIDGIIEHVQKVSNVDTEGVEPMSHPSDLAGVMREDEVHPTLTAEQALDQAPASQRDRFEVPRILGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.007 kDa

MLNEEQVKKVAHLARLELSGEEVAQFTTQLGSILDYFQQLEELNVTDVPPTTRAIESSNITRADQLHPWAERENILAIAPEQDGDFFRVPKIISTED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.411 kDa

MKRISSDEVKKVAQLARLELNESEINQHAEQLEKILEYIKQLEKINTEDIPCTTRAIEVVNVLRKDEKKNYENSEEILDLAPSRENKFFKVPKIINE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.397 kDa

MTKITKEEVNKVAHLARLELNENEINNHAEQLEKILDYIRQLEKIDTDDVPCTTRAIEVVNVFRKDEKKNSDCNEELLELGPSREDKYFKVPKILNE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.025 kDa

MKVQVDEELMRKLEKLALISLTDQERQEFMRDLTKILDFFNKIDELNLEGVEPMFHPLSTGKLRPDEPAQPLSRDDALANVPKKKDGYIIGPSTIGG

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.424 kDa

MKIKIDESYLSKLEQLALIRLKNEEKDKISNDLQRIIDFFEKINELELKDVEPLFHPISSGKLRKDEPLKPLNRDEALQNVKRKENGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.396 kDa

MKIEVNKNLIKHLENLSLIQLSQNEEKMLENDITNIIKFFEKINELDLSNVEPLFHPLPQGRLRKDTPRDPLDRENALKNVKRKENGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.396 kDa

MKIEVNKNLIKHLENLSLIQLSQNEEKMLENDITNIIKFFEKINELDLSNVEPLFHPLPQGRLRKDTPRDPLDRENALKNVKRKENGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.396 kDa

MKIEVNKNLIKHLENLSLIQLSQNEEKMLENDITNIIKFFEKINELDLSNVEPLFHPLPQGRLRKDTPRDPLDRENALKNVKRKENGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.396 kDa

MKIEVNKNLIKHLENLSLIQLSQNEEKMLENDITNIIKFFEKINELDLSNVEPLFHPLPQGRLRKDTPRDPLDRENALKNVKRKENGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.396 kDa

MKIEVNKNLIKHLENLSLIQLSQNEEKMLENDITNIIKFFEKINELDLSNVEPLFHPLPQGRLRKDTPRDPLDRENALKNVKRKENGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.396 kDa

MKIEVNKNLIKHLENLSLIQLSQNEEKMLENDITNIIKFFEKINELDLSNVEPLFHPLPQGRLRKDTPRDPLDRENALKNVKRKENGYIVGPRTYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.639 kDa

MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTNNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDQQDGMFKVPTIMEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.627 kDa

MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.627 kDa

MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.627 kDa

MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

10.627 kDa

MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.667 kDa

MSNISKETVEKVANLAKLEVSEKEATAFAGQLGKIIELVEQLNTLDTNNVEPTSHAIDVSNVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.394 kDa

MSVTKKDVEYVAELARLSFNEDEKESLASDLNQILNYVEKLQELDTEKEDIIVNPYYIENKFREDEITPSIKLEEVLENAPKTLEEYVLVPTIIREQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.394 kDa

MSVTKKDVEYVAELARLSFNEDEKESLASDLNQILNYVEKLQELDTEKEDIIVNPYYIENKFREDEITPSIKLEEVLENAPKTLEEYVLVPTIIREQ

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.085 kDa

MIDQEQVHKVANLARLELTPEEEEQFTTQLGSILDYIQQLDELDVSNVPPTTRAIDVSNITREDELQPYANRESILNSAPEQEGEFFKVPKILNSNE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.059 kDa

MRLSREIVDHVAMLARLGLTEEERELMREQLSSILEHVSRIQELDTEAIPPTAQVITLQNVWREDDVRPSLPVEAVLANAPESEDGFFRVHAVLEQS

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.36 kDa

MTKITKEEVNKVANLARLELNENEINNHAEQLEKILDYIRQLEKIDTDDVPCTTRAIEVVNVFRKDENKNSDCNEEILELGPSREDKYFKVPKIINE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.56 kDa

MSRINKEEVKKVAQLARLELNINEINNHAEQLEKILDYIRQLEKIDTDNVPCTTRAIEVINVFRKDEKKNYDRTEELLELGPSREDKYFKVPKIMNE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.938 kDa

MSKITAKDVRKVAQLARLDLPDDQIATYTEQLEKILAYVAQLEEIDTTNVKPTTRAVEVVNVTRTDEVSATPVREELLNLAPQREGDFFRVPKILAE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.057 kDa

MTKITSDDVRKVATLARLNLPEDLIDTYTSQLEKILGYVAQLEEVDTEDIPPTSRAVEVTNVLREDIIQETDIREDLINLAPNREGDFFRVPKILSE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.478 kDa

MKRISSDEVKKVAELARLELNENEIHQHAEQLEKILEYIKQLEKINTENIACTTRAIEVVNVLRKDERRDYENSDELLDLAPSRENKFFKVPKIINE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.221 kDa

MTRISSDDVRKVSKLARLEISEEHVETYANQLEEILEYIAQLEKIDTKNIPPTTRAVEVVNVLREDIVDKSNVRDKILDLAPNREGQFYRVPKILAE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.025 kDa

MSKITAKDVRKVAQLARLDLPDDQIATYTEQLERILAYVAQLEEIDTTNVKPTTRAVEVVNVTRTDEVSETPVREELLNLAPQREGDFFRVPKILAE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.247 kDa

MKIEVNNELISRLQNLALVELNDREKERIKRDIKNILDFFDQINKLDLSNVEPLFHPISTGKLRKDEIIKPLSRDEALSNVKRKEDGFIVGPATYGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.157 kDa

MLTREEVQHVAHLARLELTEEEEIQFTEQLADILAYVEQLKELDTEGVEPTFHVLDAELPTRPDQVEPYPNIEGILANAPDRADMFFKVPRILEGED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.277 kDa

MLKREEVQHVAHLARLELTEEEEIQFTEQLTDILAYVEQLKELDTEGVEPTFHVLDMELPTRPDEVEPYPDIEGILANAPDRADMFFKVPRILEGED

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.144 kDa

MIDLEQVRKVAHLARLELTPEEEQRLPSQLSAILDYVEQLSELDTDNVEPTTRAIDVSNITRTDEQKTFGDCQLLLDNAPDREDDYFRVPKILGESE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.894 kDa

MSNITADDVRKVAHLARLDLPEDTIATYTGQLERILDYVDQLQAVDTEGVPATTRAVEVVNVTREDKVEATEVREDLLEQAPLREGDFFRVPKILAE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.813 kDa

MSRISADDVRKVAKLARLDLPEEKIATYTGQLESILEYVGQLESIDTEGVPETTRAVEVTNVTREDGVTPTPVREDILNQAPQREGDFFRVPKILAD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.878 kDa

MSHISADDVRKVAQLARLDLPDDSIATFTPQLERILDFVAQLEAIDTEGLPPTTRAVEVVNVTREDGVEPTPVREELLNQAPQREGDFFRVPRILNN

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.812 kDa

MSKITADDVRKVAKLARLDLPEDTIATYTGQLERILDYVDQLQAVDTEGVPPTTRAVEVVNATREDSVVATDVRQELLDQAPQREGDFFRVPKILAD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.749 kDa

MSHISADDVRKVAKLARLNLPDDKIATYTGQLESILGYVSQLEQVDTTGVPETTRAVEVTNVTRQDGVDPTPVREEILNQAPQREGDFFRVPKILAD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.785 kDa

MSQISSDDVRKVAQLARLDLPEDKIATYTGQLESILEYVGQLQQVDTEGVPETTRAVEVTNVTRVDGVQPTAVREDILDQAPQREGDFFRVPKILAD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

97 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.984 kDa

MTTKVITAEDVRKVAHLARLAIDESEIEALTQQLDSILDYVNQLSELDVTEVPPTTRAIEVSNVTRPDVLAPWPNREDLLAIAPEREDDFFRVPKIM

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.866 kDa

MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.838 kDa

MSRISIEEVKHVAHLARLAITDEEAAMFTEQLDSIISFAEELNEVDTENVKPTTHVLQMKNIMREDVPDKGLPVEDVVKNAPDHKDGYIRVPSILD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.869 kDa

MSRISIEEVKHVAHLARLAITEEEAEMFTEQLDSIISFAEQLNEVDTENVEPTTHVLKMKNVMREDVPNKGLSIEAVIKNAPDHKDGYIRVPSILD

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln) (By similarity).

Belongs to the GatC family.

10.859 kDa

MSRISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVMREDEAGKGLPVEDVMKNAPDHKDGYIRVPSILD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.833 kDa

MSRISIEEVKHVAHLARLAITDEEAEMFTEQLDSIISFAEELNEVDTDNVEPTTHVLKMKNVMREDEAGKGLPVEDVMKNAPDHKDGYVRVPSILD

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.866 kDa

MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNELDTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.997 kDa

MAKINEEQVRHVAHLARLAVTDEEVQQFTVQLEKILGFAEQLNELDTTGIEPTTHVLDLKNVLRKDEVRPSLPRTEVERLAPDWEDGQVRVPAVFE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.949 kDa

MARITEAEVRHVAGLARLAITDEEVTHFTEQLTKILEFAEQLDELDTTGVEPTTHALDLKNVLRKDEVRPSLPREEVERMAPDWENGQVRVPAVFE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

11.054 kDa

MALTREEVLKIAKLSKLSFEDKEIEKFQVELNDILKYIDMLNEVDTSKVEPLVYINESVNNFREKEEKPSLEIEKVLFNAPESAENAIVVPKVIGE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.909 kDa

MSRISIEQVKHVADLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMRNVMREDIPEPGLPREEVLKNAPDQQDGQFRVPAILE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.899 kDa

MIDREQVRKVALLARLELTPQEEEQFTTQLGSILDYVEQLNELDVSNVPPTARAIDVSNITREDNLQPYADREAILSSAPEQEGEFFKVPKILNAE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.827 kDa

MTVDDKLIAKLEKLSSLQVDDERKEKLKSELADIINFVENLNDIDVSNIEATFSTIEGGTPLREDTSKQDLELSNHILNHAPKSEDGYFIVPKIIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.909 kDa

MSRISIEQVKHVADLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMRNVMREDIPEPGLPREEVLKNAPDQQDGQFRVPAILE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.827 kDa

MSRISIEQVKHVAHLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMKNVMREDVPTPGLPLEEVLKNAPDHQDGQFRVPAILE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.925 kDa

MSRISIEQVKHVADLARLAMTDEEAELFTKQLDAIITFAEQLNELDTENVPPTSHVLDMRNVMREDEPEPGLPREEVLKNAPDQQDGQFRVPAILE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.777 kDa

MSLTPEQVRQVAHLARLKLDEDEMERMRLQLSSILDHIEMLQAIDVTDVPITAQVTDLTNVTRIDAVTSSLPVDAALANAPDRQGDYFRVKAVFEE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.899 kDa

MIDREQVRKVALLARLELTPQEEEQFTTQLGSILDYVEQLNELDVSNVPPTARAIDVSNITREDNLQPYADREAILSSAPEQEGEFFKVPKILNAE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.827 kDa

MTVDDKLIAKLEKLSSLQVDDERKEKLKSELADIINFVENLNDIDVSNIEATFSTIEGGTPLREDTSKQDLELSNHILNHAPKSEDGYFIVPKIIE

gatC

Glutamyl-tRNA(Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.909 kDa

MSRISIEQVKHVADLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMRNVMREDIPEPGLPREEVLKNAPDQQDGQFRVPAILE

gatC

Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

96 amino acids

Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln).

Belongs to the GatC family.

10.827 kDa

MSRISIEQVKHVAHLARLAITDEEAEMFTKQLDAIITFAEQLNELDTENVPPTSHVLDMKNVMREDVPTPGLPLEEVLKNAPDHQDGQFRVPAILE