Protein
Diels-Alderase fsa2
Organism
Fusarium sp. (strain FN080326)
Function
Diels-Alderase; part of the gene cluster that mediates the biosynthesis of equisetin and fusarisetin A, 2 trans-fused decalin-containing tetramic acids with antimicrobial activity (PubMed:25770422). The PKS module of fsa1 together with the enoylreductase fsa3 catalyze the formation of the polyketide unit which is then conjugated to L-serine by the condensation domain of the fsa1 NRPS module (PubMed:25770422). Activity of the Dieckmann cyclase domain (RED) results in release of the intermediate N-desmethylequisetin also called trichosetin (PubMed:25770422). Diels-Alderase fsa2 is involved in endo-selective Diels-Alder cycloaddition to form the decalin ring of equisetin (PubMed:25770422, PubMed:28401214). Subsequent N-methylation is carried out by fsa4 to give equisetin (PubMed:25770422). The enzymatic gene responsible for the conversion of equisetin to fusarisetin A has not been identified yet and is probably located outside of the fsa cluster (PubMed:28401214).
Similarity
Belongs to the Diels-Alderase family.
Sequence
MSNVTVSAFTVDKSISEEHVLPSSFIPGSGNIFPKFTSAIPKTAWELWYFDGISKDDKSSIVIGVTRNAEGLKHGGFKVQVFVIWADERTWHRDLFFPESVVSINESGVTDGIWKDATSNSSISFSCAGDLSKASLVFDVPGVVQGDMHLEALPGDTGLDTDARLGPSVYYVRPIGRASVKAQLSLYSSDATAAEQFSLGTSANGGMDRVWSPLSWPQVMTESYYLRTQVGPYAMQIMRIFPPAGSEDQPSTMARLYREGQLVCVAQHVVTREDALMTHDSLILSKQDNSDSEDVVTGGYRDKNTGYTVEFVEKGNEGQRWKFQVRHERIIWNTPTSRPGPDATGNTGFVEVLCGGTIGESYEGVGTGGQCELS