fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

364 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

39.45 kDa

MTNYYAEITGWGKCVPPTVLSNDDLSTFLDTSDEWIRTRTGIENRRISHVNTSDMATVAAQHALARAGVEASEIDLIIVATCSPDSLIPNIASKVQQNLGIRSAAAFDLNAACTGFVYGLETGTRLIQSGNYRHAIIIGAERLSFYIDWAMRDTAVLFGDGAGAVILSRTEKETGLLQSQIGCDAKGRDILSVPKFGTCMDRFAEDNGYWDFNFVGQEIFKRAVKGMGLAAKTVLKASQLTTEQIDVVIPHQANIRIIQTLCDLSGIPQDKAFVNIQNYGNTSAATVPIALCEAVEQGRVNPGDNMLLAAFGAGLTWGAAVLKWGDRVTPIGESDAALPECEQSALELLERAIKLCNERRRDEV

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

362 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

39.025 kDa

MTQCYAEITGWGKCLPPATLSNHDLSTFLDTSDEWIQSRTGIEQRRISHVNTSDLATVAAQHAIACAGVSVEEIDLIIVATCSPDSLIPNIASRVQQNLGIPSAAAFDLNAACTGFLYGLETATRLMQASHYRHALVIGAERLSFYLDWTKRDTAVLFGDGAGAVVLSKTEQKVGLQDAQIGCDAQGRDILAVPKFGTAMDRFDADNGYWAFDFVGKEIFKRAVRGMGAAAQQVLARSGLSTEEIDVVIPHQANIRIIQTLCDLAGIAQDKAFVNIHRYGNTSAATVPIALCEALEQGKIKPHDDLLVAAFGAGLTWGAGHIRWGERITPLGKSDAQLPSCDHTALDLLSKAIEHCKRHQSE

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

362 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

38.728 kDa

MTNYYAEITGWGKCLPPAVLSNDDLSTFLDTSDEWIRTRTGIENRRISHVNTSDLATVAAKQALARAGITAQDIDLIIVATCSPDSLIPNIASMVQKNLEIEAAAAFDLNAACTGFVYGLETGTRLIQSGAYRHALIIGAERLSFYIDWAMRDTAVLFGDGAGAVVLSRTEEAVGLQNAKSGCDAQGRDILSVPKFGTSMDRFAADNGYWDFNFVGKEIFKRAVKGMGSAAAHVLAHAGMSKDDINVVIPHQANIRIIQTLCDLSGIDQSKAFVNIQKYGNTSAATVPIALCEAVEQGHIKAGDNILLAAFGAGLTWGAGLVKWGQRVEAISESDAALPECDKSALELLKNAIELCNARRDK

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

362 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

38.754 kDa

MTNYYAEITGWGKCLPPAVLSNDDLSTFLDTSDEWIRTRTGIENRRISHVNTSDLATVAAKQALARAGITAQDIDLIIVATCSPDSLIPNIASMVQKNLEIEAAAAFDLNAACTGFVYGLETGTRLIQSGAYRHALIIGAERLSFYIDWAMRDTAVLFGDGAGAVVLSRTEEAVGLQNAKIGCDAQGRDILSVPKFGTSMDRFAADNGYWDFNFVGKEIFKRAVKGMGSAAAHVLAHAGMSKDDINVVIPHQANIRIIQTLCDLSGIDQSKAFVNIQKYGNTSAATVPIALCEAVEQGHIKAGDNILLAAFGAGLTWGAGLVKWGQRVEAISESDAALPECDKSALELLKNAIELCNARRDK

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

338 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

34.926 kDa

MTASLSAPAIGILAVGAYAPAAVITNAHYATRLDTSDDWITSRTGIRERRHAAPDESSSVLGIRATQDLAGRFPGALDGVNLVICATSSPDAMFPSTAALIAGGTGLRGAAAFDVSVACSGFLYALSVGYGMIRAGLAKKALIVGSEVMSGAVDQNDRNTAILFGDGAGCVVIGEVPQGYGFQSFVLGADSAGGPHLYLRGAALRLPEGTEMGPHLTQNGREVFKFAVRTLGDSAEQAMRQAGKTTADIDWLVPHQANIRIIEAACERFGLPIERAVTNLDRYGNTSAASIPLALAEAQAQGRFKDGDQLLLAGFGGGLSWGAAALKWWSGPTGKQSS

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

335 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

36.979 kDa

MEKINAVITGVGGYVPDYILTNEEISKMVDTNDEWIMTRIGVKERHILNEEGLGSSYMARKAAKQLMKKTGANPDDIDLVIVATTTPDYHFPSTASILCDKLGLKNAFAFDLQAACCGFLYLMETAANFIRSGRYKKIIIVGADKMSSMVNYTDRATCPIFGDGAAAFMMEPTTEDLGVMDSILRTDGKGLPFLHMKAGGSVCPPSYFTVDNKMHYLHQEGRTVFKYAVSSMSDVSAAIAEKNGLTKDTINWVVPHQANVRIIEAVAHRMELPMDKVLVNIEHYGNTSAATLPLCIWDFEDKLKKGDNIIFTAFGAGFTWGAVYVKWGYDGKKES

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

332 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

36.264 kDa

MNVSKARITAIGSYVPERRLTNDDLEKMVDTNDEWIVKRTGIRERRIAADDEFTSDIGYKAVQDLIARYEKSVDDVDMIIVCTFTPDFKTPSAASLIQAKLGIQNTGAIDLNAACAGFTYGLHMANGLISSGLHRKILVIGAETISKVTDYTDRTTCILFGDGAGAVLVEYDENEPSFVSFNLGSEGERANKLYCTGLAEQMNGEELVNTGNLVQSGREVYKWAVNTVPAGMKAVLEKAAMKRNEIDWFVPHSANLRMIESICDKSGIPLEQTLYSLVQYGNTSSATIPLALDIGVREGKLKHGDNVLLYGFGGGLAHAGLILRWTVPTEKN

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

330 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

33.703 kDa

MSAARGGRAGAVVTGVGTCLPETVVDNDEVSRHLDTDHAWIHSRTGIERRRRVSPGTTTGDLAVTAGAAALKSAGRDDCDLVLLATTTPDRRCPATAPRVASRLGLRAAAAFDLSAVCSGFVYGLSVASAMITAGTCDRALVIGADVYSSIVDPDDRGTAVVFGDGAGAVLLERGDTGDPGAVLHTELGSDGTGDELITIPPDGAYLTMRGSDVYTRAVTTMAESARSTAAHAGWDLADVDAFVGHQANLRILTSVAKRLRLPPERVVSNIADVANTAAASIPLALADAAAQGRIGSGDRLLLTAFGGGLTWGSAAVVWSGAEPVQDQRS

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

328 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

35.279 kDa

MTTNFSILASAKALPTTKVTNQELTQLMATSDDWIKQRTGIRSRHVATDETTTSLAVSVAQQLLQQSRLAATAIDLIIVATMSPDYLTPATAPQVQAAIGAEKAIAFDINVACAGFVYGMQLVHQYLQPGQTALLIGSETLSRLVDWHDRSTAVLFGDGAGGLLITAKPNTTTGHWLGGHYATFGADGHYLTAGQQPQVNPWSTRTDGADSNRWAFQMNGRRVYDFATKQVPHSIEQALMQARLESSDIKAFVLHQANARIVKSVGQKLNLATEQLPMNIAQYGNTAAASEPILFAEMVAQKQVQRGDKLVFTGFGGGLSVGSAVIEY

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

327 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

36.28 kDa

MNSKSRITAIGTHVPNQILSNNDLEKMIDTNDEWIVQRTGMKERRIASEDEYSSNLAIKAVENLCTTYKKNLEDVDCIIVATTTADYVFPSVACQIQQYFNIPHTMAFDLNATCAGFTYGLHVGNSLITSGSHKKVLVVATETLSKVTDYTDRTTCILFGDGAGAILLERDENKPSFIAYHMGTNGHGGIHLYRTNLSTTMNDTPLQTNEKIVQNGREVYKWATRTVPVGIKELLHTANMKMDDIDWFIPHSANLRMIESICEKSQIPIHKTLTSVEYMGNTSSVSIPLALDLARKKGKLNNGDTLLLYGFGGGLTHLGLIVEWDLS

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

327 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

36.247 kDa

MHSKSRITAIGTYVPDQILSNNDLEKMVHTNDEWIVQRTGMRERRIASEEEYSSNLAIKAIENLCTTYKKNLEDVDCIIVATTTADYVFPSVACQIQQYFNIPHTLAFDLNATCAGFTYGLHVGNSLITSESHEKVLVVATETLSKVTDYTDRTTCILFGDGAGAILLERDENTPSFIAAHMGTNGDGGIHLYRTNLSTTMNGTPLQTNEKIVQNGREVYKWATRTVPKGIKNLLHTVNMQVDDIDWFIPHSANLRMIESICEKSQIPIQKTLTSVEYMGNTSSVTIPLALNLAIKEGKLNNGDTLLLYGFGGGLTHLGLIVEWNLI

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

326 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

36 kDa

MQSFAKITAQGTYVPEKVMDNNDFEKIVETSDEWIQQRTGIIERRIADENEYTSDLSYKAVLDLQEKYQVDLTDVDMIINTTLTPDYKTPSVASYVQAQLGLKNAGAIDINAACAGFTYGLNLANGLITSGQNKKILVIGSETLSKITDYNDRSTCILFGDGAGAFLVEYDKEEMSFIASNAGSDGLKGHNLYCTELSEEMFSDDLENHGYIVQNGRGVYKWAVGNVPNIIHEVLNQSNYSIEDLNWFVPHSANARMIESICEKANIETDKALKSLKYYGNTSSATIPLSIDLAIKEGKIKKDDLILLVGFGGGLAYASTLIRWTI

fabH2

3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 2

315 amino acids

Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first condensation reaction which initiates fatty acid synthesis and may therefore play a role in governing the total rate of fatty acid production. Possesses both acetoacetyl-ACP synthase and acetyl transacylase activities. Its substrate specificity determines the biosynthesis of branched-chain and/or straight-chain of fatty acids.

Belongs to the thiolase-like superfamily. FabH family.

32.372 kDa

MNGSRIAAVGHYQPAKVLTNEDLASLVDTSDEWIRSRVGIRTRHFAGPDEPVDELAGHAAAKALASAGLAPADIDLVLVATSTAEDRSPNMAARVAARLGIPSPAAMDINVVCAGFTHALATADHAVRAGAATRALVIGADKMSAVTDWSDRTTCVLVGDGAGAAVVDACPEGAEPGIGPVLWGSVPEMGHAVRIEGTPPRFAQEGQSVYRWATTQLPAIARRACERAGLTPADLAGVVLHQANLRIIEPLAAKIGAVNAVVARDVVESGNTSAASIPLAFSKLVERGEISTGDPVLLFGFGGNLSYAGQVIRCP