Organism
Drosophila melanogaster
Function
Transcription factor that can both stimulate and repress transcription. Binds to the consensus DNA sequence 5'-A/GCAGGTG-3'. Regulates cell motility and adhesion during tracheal morphogenesis by stimulating transcription of the DE-cadherin gene shg at branch tips, thereby promoting tracheal tube fusion. Maintains diploidy in imaginal cells by inhibiting the transcription of genes required for endoreplication. Required for development of the genital disk and acts as an intrinsic determinant of wing cell fate. The somatic protein is required for maintenance of male germ cells. Acts with other members of the snail protein family to control embryonic central nervous system development.
Similarity
Belongs to the snail C2H2-type zinc-finger protein family.
Sequence
MHTVEDMLVEKNYSKCPLKKRPVNYQFEAPQNHSNTPNEPQDLCVKKMEILEENPSEELINVSDCCEDEGVDVDHTDDEHIEEEDEDVDVDVDSDPNQTQAAALAAAAAVAAAAAASVVVPTPTYPKYPWNNFHMSPYTAEFYRTINQQGHQILPLRGDLIAPSSPSDSLGSLSPPPHHYLHGRASSVSPPMRSEIIHRPIGVRQHRFLPYPQMPGYPSLGGYTHTHHHHAPISPAYSENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSEGGCPGGSAGSSSSSELNYAGYAEP