emm6

M protein, serotype 6

483 amino acids

Mediates the attachment of S.pyogenes to skin epithelial cells through the binding of the human membrane cofactor protein CD46. Also binds to the factor H and factor H-like protein 1. These interactions could contribute to the fact that the M6 protein protects the bacterium from the phagocytosis by regulating the complement activation on the bacterial surface.

Belongs to the M protein family.

53.472 kDa

MAKNNTNRHYSLRKLKKGTASVAVALSVIGAGLVVNTNEVSARVFPRGTVENPDKARELLNKYDVENSMLQANNDKLTTENNNLTDQNKNLTTENKNLTDQNKNLTTENKNLTDQNKNLTTENKELKAEENRLTTENKGLTKKLSEAEEEAANKERENKEAIGTLKKTLDETVKDKIAKEQESKETIGTLKKTLDETVKDKIAKEQESKETIGTLKKTLDETVKDKIAKEQESKETIGTLKKILDETVKDKIAREQKSKQDIGALKQELAKKDEGNKVSEASRKGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDAKPGNKVVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN

emm6

M protein, serotype 6

415 amino acids

Mediates the attachment of S.pyogenes to skin epithelial cells through the binding of the human membrane cofactor protein CD46. Also binds to the factor H and factor H-like protein 1. These interactions could contribute to the fact that the M6 protein protects the bacterium from the phagocytosis by regulating the complement activation on the bacterial surface (By similarity).

Belongs to the M protein family.

45.751 kDa

MAKNNTNRHYSLRKLKKGTASVAVALSVIGAGLVVNTNEVSARVFPRGTVENPDKARELLNKYDVENSMLQANNDKLTTENKNLTDQNKELKAEENRLTTENKGLTKKLSEAEEEAANKEQESKETIGTLKKILDETVKDKIAREQKSKQDIGALKQELAKKDEGNKVSEASRKGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRKGLRRDLDASREAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDAKPGNKVVPGKGQAPQAGTKPNQNKAPMKETKRQLPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN