Eif4e1b

Eukaryotic translation initiation factor 4E type 1B

244 amino acids

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Belongs to the eukaryotic initiation factor 4E family.

27.985 kDa

MNKVEGGGHKEEVVVKEKEVVKEKPSEATAEGVQAGEAKDLPGSLKTQRRKAHREHPPEVLSKLHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKSNNLANKFVV

EIF4E1B

Eukaryotic translation initiation factor 4E type 1B

242 amino acids

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structure.

Belongs to the eukaryotic initiation factor 4E family.

27.596 kDa

MLAVEVSEAEGGIREWEEEEKEEEAAERTPTGEKSPNSPRTLLSLRGKARTGGPMEVKLELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKFVV

eif4e1b

Eukaryotic translation initiation factor 4E-1B

214 amino acids

Does not appear to be a mRNA-cap-binding protein.

24.745 kDa

MASCAVQLIDKVPKKKVEKKKFEPNILKEPCMKHPLQNRWGLWFYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQLPSKLSSGCDYSMFKDGIEPMWEDRSNKCGGRWLITLAKQHRHTELDHFWLETLLCLIGEGFSSFSRDICGSVINIRAKGDKIALWTSNAENCETVTYIGRKYKESLGLPQKLVIGYQAHADTATKSNSITKNKFVV