efp

Elongation factor P

195 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.705 kDa

MIVEPTVATYNTSDFRKGLKVQIDGEPYLITEMNFVKPGKGNAMYKCKMKNLIRGTTLDRTYKGGDSLEAADVETTTVQFLYRQGQDYVFMDGTTFEQYEVPNEVAGDIWKYLKDGTECSMTLYNGAAIIVEPPQHVQLEVTECGPGTKGDTATNVTKPAMVETGAEFNVPGFIKEGNIIKINTLNNEYVERVNN

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.562 kDa

MAVVKSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEASVQYLYKDKDVLVFMDLETYDQISLDLKENANFQDKVLFLQESEIYSLIMFDNVVIDIKLAPKIAFEVVEVEAAVKGDTVTNAMKNITLNTGLIIKAPLFINVGDKVLVNSETKEYAERIKN

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

21.807 kDa

MATEIDINRIQKDIFIEHKGEPYRVLDYEHVKPGKGQAFVRVKAKNMLTGNVTELTFKASDRIPLADFEQVYATYSYNDGENYYFMNTQTYDMIAVPKEKIEEEAKFLKEGMEVIVFLYKGQPIGIELPKHVELQVVETEPAFKGDTQAGGTKPAKLETGAVIQVPFFVKEGDIVKVDTRTGSYVERVKEAK

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-37 is required for alleviation.

Belongs to the elongation factor P family.

21.121 kDa

MPVMASYSTNEFKQGLKVMLDGNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDSLEAADIVEVEMDYLYNDGELWNFMDPVTFEQIAADKVAMGDAAKWLKDDSNEKCSIMLFNGVPLNVSAPNFVVLKIVETDPGVRGDTSGGGGKPAKLETGAVVRVPLFVQQEDSVRVDTRTGEYLERA

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-38 is required for alleviation.

Belongs to the elongation factor P family.

21.215 kDa

MRIIMATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLNYSYKDEDFWYFMHPETFEQYSADSKAVGDAEKWLLDQAECIITLWNGSPISVTPPNFVELEVVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFIQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.711 kDa

MADTSDFRNGMTFIWKDDLWEIVDFLHVKPGKGGAFVRTTLKNVKDGHEVEETFRAGAKVDEVRVERREHQYLYEDDYGLHFMDQESYEQFSMPPEQVEGREFLKEGGDVDIVFRADTEEPLRTEVPQKVDLEVTETTPGVKGDTAQGGDKPATLESGATIDVPLFINEGDVVRLNTETEEYETRVSAASTV

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.452 kDa

MAVVKSSEIEKGSFLLIKGTPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEVSAQYLYKDKDVLVFMDLETYDQVSLDLKESANFQDKVPFLQESETYALIMFDNVVIDIKLAPKIAFEVVEVEAAVKGDTVTNAMKNITLNTGLVVKAPLFINVGDKVLVNSETKEYAERIKS

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

21.413 kDa

MAVVKSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEVSAQYLYKDKDVLVFMDLETYDQVSLDLKESANLQDKVPFLQESEIYSLVTFDNVVIDIKLAPKIAFEVVEVEAAVKGDTVTNAMKNITLNTGLVVKAPLFINVGDKVLINSETKEYAERIKN

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.413 kDa

MAVVKSSEIEKGSFLLIKGAPHIVLEREFSKTGRGGAIVRLKLKNLKNKFVIRETLKGADTAEAIEIYEVSAQYLYKDKDVLVFMDLETYDQVSLDLKESANLQDKVPFLQESEIYSLVTFDNVVIDIKLAPKIAFEVVEVEAAVKGDTVTNAMKNITLNTGLVVKAPLFINVGDKVLINSETKEYAERIKN

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.668 kDa

MSTIKSGDIDKGSFLLFKGMPHIVLEREFSKMGRGGSIVRLKLKNLKNKSVIKETLKGSDTVEEIEVLEVNSQYLYKDNESLIFMDLETYDQFSVNLRDVVNLEDKVLFLQEAEVYSLIKWGNEVIDLKLPPKVAFEVIDAEIAVKGDTVTNAMKNVTLHTGLVVKAPLFINIGDKILVNSETKEYAERVKV

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.654 kDa

MGTIKSGEIEKGSFLLFKGMPHIVLEREFSKMGRGGAIVRLKLKNLKNKSVVKETLKGADTVEEIEVLEVSSQYLYRDSENLIFMDLETYDQFNVNLREVPNIEDKVLFFQEAEVYSLVKWDNEVIDLKLPPKVAFEVVAAEAAVKGDTVTNAMKNVTLHTGLVVKAPLFINVGDKILVNSETKEYAERVKE

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.712 kDa

MSTIKSGDIDKGSFLLFKGMPHIVLEREFSKMGRGGSIVRLKLKNLKNKSVIKETLKGSDTVEEIEVLEVNSQYLYKDNESLIFMDLETYDQFSVNLRDVVNLEDKVLFLQEAEVYSLIKWGNEVIDLKLPPKVAFEVVDAEIAVKGDTVTNAMKNVTLHTDLVVKAPLFINIGDKILVNSETKEYAERVKV

efp

Elongation factor P

192 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.74 kDa

MGTIKSGDIEKGTFLLFKGMPHIVLEREFSKMGRGGSIVRLKLKNLKNKSVVKETLKGADTVEEIEVLEVASQYLYRENENLIFMDLETYDQFDVNLREISNIEDKVMFLQEAGIYSLVKWDNEVIDLRLPPKVAFEVVDAEIAVKGDTVTNAMKNVTLHTGLVVKAPLFINVGDKILVNSETKEYAERVKE

efp

Elongation factor P

191 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.412 kDa

MKINGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGGAFNQVEMKNLIDGTKLNERFRAAETVERVRLEQKDFTFLYQQGDALIFMDSQSYEQLELQKDFVGERAAFLQDGMTVTVELYQEKPIGISLPDQVSVTIVEADPALKGQTVTASYKPAILENGIRILVPPFINAGERIIVDTNELIYVRRANEKDK

efp

Elongation factor P

191 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.413 kDa

MKINGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGGAFNQVELKNLLDGTKLNERFRAAETVERVRLEQKDFTFLYQQGDALVFMDSESYEQLELQKDFVGERAAFLQDGMTVTVELYQEKPIGISLPDQVAVTIVEADPALKGQTVTSSYKPAILENGIRILVPPFMNAGERIIVDTNELIYLRRANEKDK

efp

Elongation factor P

191 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.764 kDa

MANFSTNQFKAGLKIMLDGEPCNILENELVKPGKGQAFSRVKIRKLVSGKVLEKTFKSGETVEGADVMEVELAYLYADGEFWHFMNNETFEQIGAEEKALGETVKWLVEGDICTITLWNGTPITVTAANFVEIDITETDPGLKGDTAGTGGKPATLATGAVVRVPLFVQIGEKVRIDTRSGEYVSRATKAQ

efp

Elongation factor P

191 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.013 kDa

MANISTSEMRSGSKVMVDGDPCAIIDNEHVKPGKGQAFNRIKLRNLKTGRVWERTFKSGDTLETADVMDTDMEYLYTDGEFWHFMAVDGSFEQHAADETAVGDTIKWLKEQEKYVVTLYNGAPLAVAAPNFIELEVKETDPGVKGDTANGGSKPAFLVTGAMVRVPLFINIGEVLRVDTRTGEYVSRATGK

efp

Elongation factor P

191 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.114 kDa

MASFSTNEFKAGLKVMYDGNPCAIIDNEFVKPGKGQAFNRVKLRNLRTGKVLEQTFKSGESLEGADVVDTEMNYLYNDGEFWHFMHPETFEQLQADANAMADAKQWLKENGNDLCTITLFNGVPLSVTAPNFVELEIVETDPGVRGDTSGGGGKPARLETGAVVRVPLFVQQNEVVRVDTRTGDYQTRVSQ

efp

Elongation factor P

191 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.368 kDa

MALKIAQELRAGNVFMIGNDAMVVLKTEYSRSGRSGAVVKMKYKNLLTGAGGESVFNADDKMDQVILEKKEAEYSYFDGTMYVFMDPVTYEQYNVEPAAMGSALNYLQDGMKVEVTFYNENAISVELPTTVVREIVYTEPAVKGDTSSGKVLKAARINDNEEFTIMVPLFCNIGEKIEIDTRTDEYRSRAK

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.175 kDa

MKINGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGGAFNQVELKNVIDGTKLNERFRAAETVEKVRLEQKDFTFLYQQGEALVFMDTESYEQLELQRDFVGDRAAFLQDGMTVTVELHEEKPLGISLPDQVTVTIAEADPAIKGQTVTSSYKPAILENGIRILVPPFVQAGERIIVDTNELTYIRRVSEKG

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.213 kDa

MKINGNEIRPGNVIEHQGSLWVAIKCNAVKPGKGGAFNQVEMKNLIDGTKFNERFRAAETVERVRLEQKDFTFLYQQGDALIFMDSQSYEQLELQKDFVGERAAFLQEGMTVTVELYQEKPIGISLPDQVSVTIAEADPALKGQTVTASYKPAILENGIRILVPPFINAGEHVIVDTNELVYLRRANDKG

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.274 kDa

MGVKIGINQIKKDMFIVHDGQPYRVLDYDHVKPGKGQAFVRVKAKNMKTGNVIEITYKSSESIELADFEQRQMSYSYFDGDSYWFIDMNTGDMIAVPASVLGDEAQFLKEGMEVFIFLDKGQPIGVELPKSAVYEVIETEPGFKGDTATSTLKPAKIDTGATVQVPLFINEGDKIKIDTRTGKYIERVNE

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.655 kDa

MGVKIDINRIARDQFILVDNQPYKVVSYEHVKPGKGQAFVRVKAKNMRTGNVTEFTFKSSDSIELADFEQRFMNYSYTDGTYYYFLDTNTYETFAVPAEAMEHEAQFLKEGMQVVVFLDRGNPIGIELPKHEVYEVIETEPGFKGDTATNTLKPAKIETGATVQVPLFINVGDRIKVDTEKGTYIERVNK

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.435 kDa

MATTSDFRNGLCIEFNNDLYTIVEFQHVKPGKGGAFVRTKLKSLTNGKVIDNTFNSGVKITTARIERKTYQFLYKDGAGYHLMDNNTFEQLDLDEKAIQNPLLIKEGQELDVLFHQETGNFIGCELPPFVELKVTYTEPGLKGDTATRALKPATLETGLQIQVPLFIDNDEIIKIDTRTIAYVERVKTDI

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

21.914 kDa

MAEMIEAKNLRNGQTIFGPNKEILLVLENTFNKTAMRQGIVKTKVKNLRTGAIVWLEFTGDKLEQVIIDKKKMNFLYKDGNNFVFMDQKDYSQIEINEKKLEWEKNFITEEIEVTVITYQDEILGVNLPDLVPIEVEFAEDAIQGNTANMARKKARLVTGYELDVPQFINTGDKIVIATVDGNYRERFNK

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

21.81 kDa

MADMIEAKSLRSGQTIFGPNKEILLVLENTFNKTAMRQGIVKTKVKNLRTGAIVWIEFTGDKLEQVIIDKKKMTFLYKDGANYVFMDQQDYSQIEIPEKQLEWEKNFITEDSEVTIISYQSEILGVNLPELVPIEVEFAEEAVQGNTANMARKRARLVSGYELDVPQFIRTGDKIVISTIDGSYRERYNK

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.779 kDa

MANYSTNEFKSGLKIMLDGDPCSIIENEFVKPGKGQAFNRVKFRNLKSGRVGERTFKSGDSVEGADVVDLDMEYLYTDGEFYHFMLTDGSFEQHAADVSAVGDTTKWLKEQDVYTVTLYNGAPLSVSPPNFVELEIVETDPGVRGDTAQGGSKPAKLTTGAVVAVPLFINQGEMIKVDTRSGEYVSRVKS

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.414 kDa

MKTAQEMRVNSVALIDGQPWLIQKAEFTKSGRNSAIVKMKLKNLLNGSKTETVYKADDKMEPVILERKEVNLSYISGEDYVFMDPEYNSYELRAEDLESVLPFIEEGMTDVCEAVFFEGKVISVDLPTTIVRQVVYTENAARGDTSGKVMKPAKLRNGTEIKVAEFVDIDDWIEIDTRDGSYKGRTQAPA

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.902 kDa

MASFSTNEFKAGLKVMLDGNPCAILENEFVKPGKGQAFNRVKLRNLRSGKVLEQTFKSGDSLEAADVMDTEMNYLYNDGEFWHFMHPESFEQIQADKTAMSDSTKWLKENSNALCTITLFNGAPLSVTPPNFVELQITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVQQGEVVRVDTRTGDYQTRVN

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.904 kDa

MASFSTNEFKSGLKVMLDGNPCAILENEFVKPGKGQAFNRVKLRNLRSGKVLEQTFKSGDSLEAADVMDTEMNYLYNDGEFWHFMHPESFEQIQADKTAMSDSIKWLKENSNALCTITLFNGAPLSVTPPNFVELQITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVQQGEVVRVDTRTGDYQTRVS

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.165 kDa

MKTGKELKPGTVIRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEATLSFISGDTYTFMDTTDYTMYELNAEDIEAVLPFIEEGMTDVCEAVFFEDRLVSVDLPTTIVRQVDYTEGSARGDTSGKVMKPAKLKNGTELSVADFIEIGDMIEIDTREGGSYKGRAKV

efp

Elongation factor P

190 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.316 kDa

MKTGKELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEATLSFISGDTYTFMDTTDYTMYELNAEDIEAVLPFIEEGMEDVCEAIFFEERLVSVELPTTIVRKVAYTEGSARGDTSGKVMKPAKLSNGTELQVADFIEIDDLIEIDTREGGSYKGRAKK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.483 kDa

MHFYRTNEFRVGLKIMLNGEPYAIIENEFVKPGKGQPFNRVRLRQLLSGKKIIEKIFKSGDAVEAADIIDRHLNYLYNNGEFWYFINNQNYELVAADAKAVGDYAKWLVKQTPCVLTLWKDQPIAVVPPNFVELEVLSTDPGIKGDAISSIYKPATLTTGVIVKVPLFINKGEIIKVDTRTSMYISRVK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.323 kDa

MAERGSDIRPGHILEHNNALYLVVKVMHTQPGKGGAYIQAEMKNLKTGAKQYERFRTDGDIKRAIVDESDYQYIYGDGSMITVMHLKTYEQITISKDILGDKSIYLQDNIVITLVFYNGEIISAKVPDYVTLRVIETEAVIKGQTVSSSSYKVAMLENNQRISVPTFIKPGDKIVVYTPDDSYYERAKG

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.277 kDa

MAERGSDIRPGHVLEHNNALYLVVKVMHTQPGKGGAYIQAEMKNLKTGAKQYERFRADGDIKRAIVDESDYQYIYGDGSMITIMHLKTYEQLTISKDILGDKSIYLQDNIIITLVFYNGEIISAKVPDYVTLQVVETEAVIKGQTVSSSAYKVAMLENNQRISVPTFIKPGDRIVVYTPDDSYYERAKG

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.391 kDa

MAERGSDIRPGYVLEHNNALYLVVKIMHTQPGKGGAYIQAEMKNLKTGAKQYERFRADGDIKRAILDEADYQYIYGDDSMLTVMHLGNYEQITIKKDILGDKSIYLKDNMVITLLSYNGEIISAKVPDYVTLQVIETEAVIKGQTVSSSSYKVAMLENNQRINVPTFIKSGDKIVVYTPDDSYYERAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.391 kDa

MAERGSDIRPGYVLEHNNALYLVVKIMHTQPGKGGAYIQAEMKNLKTGAKQYERFRADGDIKRAILDEADYQYIYGDDSMLTVMHLGNYEQITIKKDILGDKSIYLKDNMVITLLSYNGEIISAKVPDYVTLQVIETEAVIKGQTVSSSSYKVAMLENNQRINVPTFIKSGDKIVVYTPDDSYYERAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.703 kDa

MINTNDFKTGQTIKFNNQIYQIIEFLHVKPGKGTAFVRSKLRNLRTGSVIDHTFNAGIKLEPALINKIKMQFLYSSQEKYIFMNTQTYEQLEINKDQLKEKLHYLYEGLLVEIIFYNNNEILTISLPDKISLKVTYAEPGVKGDTKTNSFKDATLETGLVIKVPLFINTGEKIIVNTETGLYLSRDNNK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.721 kDa

MRIYHSNNFRSGRKIIFENEPCLIESSEFVKPGKGQSFVRVKLRKLLTKQLIEKTFKSTDSLEIADIIEYTLSYLYNDGRFWYFINNNTFEELSVDEKIIGVHKKWLLEQDTCIVTLWNNQPISITPNNFVNLKVIHVQATLKGDTINTSSTKLATLSTGAIVRVPLFIQVGSLIKVDTRSGEYVSRIK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.786 kDa

MELCHSNQLKIGLKIIYNNEPCIVVSNEFIKPGKGQAFFRVRLKNLLNKKLIDKTCKYSDCFKIANVIEITATYMFTDKKVWTFMDKKSFEQIFVEKNIIKNVLPWLLEQHDYIISLWNDQPISIVYSSNFIELIVVNTIPNARSGAINTYSKLALLNTGVTIKVPIFIQIGQIIKVDTRTSEYISKIS

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.927 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEYWHFMVPDTFEQYAVTENVLADAAQWLKEQDVCVLTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.927 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEYWHFMVPDTFEQYAVTENVLADAAQWLKEQDVCVLTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.887 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEHWHFMVPDTFEQYAVTENVLADAAQWLKEQDVCVVTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.901 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEHWHFMVPDTFEQYAVTENILADAAQWLKEQDVCVVTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.721 kDa

MRIYHSNNFRSGRKIIFENEPCLIESSEFVKPGKGQSFVRVKLRKLLTKQLIEKTFKSTDSLEIADIIEYTLSYLYNDGRFWYFINNNTFEELSVDEKIIGVHKKWLLEQDTCIVTLWNNQPISITPNNFVNLKVIHVQATLKGDTINTSSTKLATLSTGAIVRVPLFIQVGSLIKVDTRSGEYVSRIK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.786 kDa

MELCHSNQLKIGLKIIYNNEPCIVVSNEFIKPGKGQAFFRVRLKNLLNKKLIDKTCKYSDCFKIANVIEITATYMFTDKKVWTFMDKKSFEQIFVEKNIIKNVLPWLLEQHDYIISLWNDQPISIVYSSNFIELIVVNTIPNARSGAINTYSKLALLNTGVTIKVPIFIQIGQIIKVDTRTSEYISKIS

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.927 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEYWHFMVPDTFEQYAVTENVLADAAQWLKEQDVCVLTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.927 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEYWHFMVPDTFEQYAVTENVLADAAQWLKEQDVCVLTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.887 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEHWHFMVPDTFEQYAVTENVLADAAQWLKEQDVCVVTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.901 kDa

MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEHWHFMVPDTFEQYAVTENILADAAQWLKEQDVCVVTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.145 kDa

MVKVIASSVRKGNVLEVDGKLYVVLTAQNFHPGKGTPVTQIDMRRIVDGVKVSERWRTTEQVERAFVEDVNHQFLYEDGEGFHFMNPENYDQIVVDVETMGDQKAYLQEGMTCVISMYEGVALALDLPRHVTLEIMETEPVVKGQTASSSYKPAMLSNGIRTLVPPHINAGTRVVIATEDNSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.986 kDa

MANYSTSEFKSGLKVMLDGDPCSIIENEFVKPGKGQAFSRVKLRNLRNGKVWERTFKSGDSLEGADVMDVSMQYIYSDGEFWHFMDQTSFEQKQADETAVRDAKQWLKEEDICEVTLYNGEPLSVSPPNFVELEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIVKVDTRTGDYVGRIKQ

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.74 kDa

MAQYSTNEFKGGLKIMLDGDPYTIVENEFVKPGKGQAFNRVKVRNLKTGKVIDRTFKSGESVEAADVLETEMQFLYSDGEFFHMMDPETFEQKAAPASAVGDAAKWLKEQAMCTVILWNDEPLTVEPPNFVELRVVETDPGVRGDTSGGGGKPATLETGAVVRVPLFIEEGELLKVDTRSGEYVGRVKG

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.657 kDa

MINTNDFKTGKTIKFNNQIYQILEFLHVKPGKGSAFVRTKLRNLRTGSVIDYTFNAGIKVQPALITKIKMQLIYVLEDNYIFMNTQNYEQLEINKYQLKDFLKYLYEGLLVDIIFYENDEIVGISLPEKISIKVAYTEPGAKGDTKTNSLKDATLETGLVIKVPLFINIGEKIIINTETGLYLSRDNNK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.205 kDa

MAAGTTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAEIDIVRIERRPMQYLYREGDSFIFMDNDTFDQIPVSADLVGDAVRFMKENETVDLVYDAEKDTIIGVELPIFVNLKVVETTVAVRGDTATNVTKPATLETGAVIEVPAFINEGDVLKIDTRTGEYITRV

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.204 kDa

MAAGTTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAEIDIVRIERRPMQYLYREGDSFVFMDNDTFDQIPVSAELVGDAVKFMKENETVDLVYDAEKDQIIGVELPIFVNLKVVETTVAVRGDTATNVTKPATLETGAVIEVPAFINEGDVLKIDTRTGEYITRV

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.205 kDa

MAAGTTSDLRNGIVIRYNNDLYQVVEFQHVAPGNWRAFVRMKLKSLTTGKVIEDRVRAGAEIDIVRIERRPMQYLYREGDSFIFMDNDTFDQIPVSADLVGDAVRFMKENETVDLVYDAEKDTIIGVELPIFVNLKVVETTVAVRGDTATNVTKPATLETGAVIEVPAFINEGDVLKIDTRTGEYITRV

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.043 kDa

MATYSTNEFKGGLKIMLDGDPFTIVENEFVKPGKGQAFNRVKLRNLKTNRVVEKTFKSGESVEAADVMETELQYLYNDGEFWYFMDPTSFEQKAAPSSAVGDAANWIKEQDTCTVILWNDTPLQVEAPNFVDLKVIETDPGVRGDTSSGGTKPAKLETGATVRVPLFIEEGEVLRVDTRKAEYVSRAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.936 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRISDGVKVSERYRTTEQVERAFVEDREHTFLYEDGEGFHFMNPETYDQLVMSSEDIGDLKAYLQEGMAVMLSIHEGIAIAIDLPRHVTLEITETEPVVKGQTASSSYKPAVLSNGVRTLVPPHIQAGTRVVIATEDGSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.106 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGTKVSERWRTTEQVERAFVEDLNFQFLYEDGEGFHFMNPENYDQVVVDVETMGDQKAYLQEGMTCVLSIHEGNPLAVELPRHVTLEIVETEPVVKGQTASSSYKPAILSNGIRTMVPPHIDAGIRVVIATEDNSYVERAKN

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.894 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRISDGVKVSERYRTTEQVERAFVEDREHTFLYEDAEGFHFMNPESYDQLVMSADDIGDLKAYLQEGMAVMLSIHEGIAIAIDLPRHVTLEITETEPVVKGQTASSSYKPALLSNGVRTSVPPHIQAGTRVVIATEDGSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.948 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRISDGVKVSERYRTTEQVERAFVEDREHTFLYEDGEGFHFMNPETYDQLVMSTEDIGDLKAYLQEGMAVMLSIHEGLAIAIDLPRHVTLEIVETEPVVKGQTASSSYKPAVLSNGVRTLVPPHIQAGTRVVIATEDGSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.892 kDa

MANYSTNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEMNYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDDSNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGVRGDTSGGGGKPAKLETGAVVRVPLFVQQEESVRVDTRTGEYLERA

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.892 kDa

MANYSTNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEMNYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDDSNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGVRGDTSGGGGKPAKLETGAVVRVPLFVQQEESVRVDTRTGEYLERA

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.892 kDa

MANYSTNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEMNYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDDSNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGVRGDTSGGGGKPAKLETGAVVRVPLFVQQEESVRVDTRTGEYLERA

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.892 kDa

MANYSTNDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEMNYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDDSNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGVRGDTSGGGGKPAKLETGAVVRVPLFVQQEESVRVDTRTGEYLERA

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.106 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGTKVSERWRTTEQVERAFVEDLNFQFLYEDGEGFHFMNPENYDQVVVDVETMGDQKAYLQEGMTCVLSIHEGNPLAVELPRHVTLEIVETEPVVKGQTASSSYKPAILSNGIRTMVPPHIDAGIRVVIATEDNSYVERAKN

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.893 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAANFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVNFQYLYEDGEGFHFMNPVSYDQVVVDVETMGDQKAFLQEGMTCVLSMHEGIALALQLPRHVTLEIAETEPVVKGQTASSSYKPAILSNGVRTLVPPHINAGTRVVIATEDVSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.966 kDa

MVKVIASSLRKGNVVDIDDKLYVVLTAENIHPGKGTPVTQLDMRRISDGVKISERYRTTEQVERAFVEDRPHTFLYEDSDGYTFMNPENFDQVIVTKDVMGDSAVYLQEGMECMLSTHNGVPIAIELPARVTLEIVDTEPTVKGQTASSSYKPAKLSNGVRTMVPPHISAGTRVVIMTADNSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.045 kDa

MATFSTNEFRGGLKIMLDGDPYTIVENEFVKPGKGQAFNRTKVRNLKTGRVLERTFKSGESVEAADVLEMNMQYLYKDEDNWYFMNPETFEQLPAAQAAVADAEKWLLEQDECTVVLWNNNIISVTPPNFVERKIVDTDPGLRGDTSGGGGKPATLETGAVVRVPLFLNIGDTIKVDTRSGEYLGRAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.818 kDa

MAGYSTSEFKSGLKVMMDGDPYTIMENEFVKPGKGQAFNRVKLRNLKTGRVIDRTFKSGDSLEAADVIETQLQYLYSDGEFWHLMSPETYEQYSADAAAVGDSTKWLKEQDTCTVTLWNGAPLLVSPPNFVTLKVTETDPGIRGDTSGGGSKPATLETGAVVRVPLFIDVGEMLKIDTRTGEYVERAKE

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.591 kDa

MINTNDFKTGQTIKFNNQIYQILEFLHVKPGKGAAFVRTKLRNLRTGSVIDYTFNAGIKVQPALITKIKMQFLYALEDNYIFMNTQNYEQLEINKHQLKDFLKYLYEGLLVDIIFYENDEIVGITLPDKISIKVAYTEPGAKGDTKTNSLKDAALETGLVIKVPLFINIGEKIIINTETGLYLSRDNNK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.429 kDa

MKILANAIREGNILEYQNNLWIVSKKPDHTKPGKGGAYIQLEMKNLKTGTKIYERFSSSDYLEKATLEQRNYQYLYQENNHLVLMDLESFEQILVQKSIIASNKLPFLLENTVVTVETYKDEPIRLVLPHTVVVEILETSPNIKGATVTASYKPAILSNGAKIMVPPYLSAGEKIVVKLEDISFVERAK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.443 kDa

MKILANAIREGNILEYQNNLWIVSKKPDHTKPGKGGAYIQLEMKNLKTGTKIYERFSSSDYLEKATLEQRNYQYLYQENNHLVLMDLESFEQILVQKSIIASNKLPFLLENTVITVETYKDEPIRLVLPHTVVVEILETSPNIKGATVTASYKPAILSNGAKIMVPPYLSAGEKIVVKLEDISFVERAK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.303 kDa

MKTGKELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEATLSFINGDEYTFMDTTDYTMYELNAEDIEAVLPYIEEGMEDVCEAVFFEGRLVSVELPTTISRKVVYTENAARGDTSGKVMKPAKLANGTEISVADFIQIDEWIDIDTRDNSFKGRSKK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.01 kDa

MKTGKELKPGTVIRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEATLSFISGDSYTFMDTTDYTMYELNAEDIESVLPFVEEGMTDVCEAVFFEGRLVSVELPTTIVRQVDYTEGSARGDTSGKVMKPAKLKNGTELSVADFIEIGDMIEIDTREGGSYKGRAK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.332 kDa

MKTGKELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEATLSFISGDSYTFMDTTDYTMYELNAEDIDAVLPYIEEGMEDICEAVFFEGRLVSVELPTTISRQVVYTENAARGDTSGKVMKPAKLKNGTEIQVADFIQIDEWIDIDTRDNSFKGRSKK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.303 kDa

MKTGKELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEATLSFINGDEYTFMDTTDYTMYELNAEDIEAVLPYIEEGMEDVCEAVFFEGRLVSVELPTTISRKVVYTENAARGDTSGKVMKPAKLANGTEISVADFIQIDEWIDIDTRDNSFKGRSKK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.332 kDa

MKTGKELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEATLSFISGDSYTFMDTTDYTMYELNAEDIDAVLPYIEEGMEDICEAVFFEGRLVSVELPTTISRQVVYTENAARGDTSGKVMKPAKLKNGTEIQVADFIQIDEWIDIDTRDNSFKGRSKK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.138 kDa

MKTGKELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEATLSFISGDTYTFMDTTDYTMYELNAEDIESVLPFVEEGMTDVCEAVFFDERLVSVELPTTIVRQVDYTEGSARGDTSGKVMKPAKLKNGTELSVADFIEIGDMIEIDTREGGSYKGRAK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.124 kDa

MKTGKELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEATLSFISGDTYTFMDTSDYTMYELNAEDIESVLPFVEEGMTDVCEAVFFEDRLVSVELPTTIVRQVDYTEGSARGDTSGKVMKPAKLKNGTELSVADFIEIGDMIEIDTREGGSYKGRAK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.039 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVNFQYLYEDGEGFHFMNPANYDQVVVSQETMGDQKAYLQEGMTCILSIHEGIPLALELPRHVTLEIVETEPVVKGQTASSSYKPAMLSNGIRTSVPPHIDAGTRVVIATEDNSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.955 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVNFQYLYEDGEGFHFMNPATYDQVVVSAETMGDQKAYLQEGMTCILSIHEGVPLALELPRHVTLEIVETEPVVKGQTASSSYKPAMLSNGIRTSVPPHIDAGTRVVIATEDNSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.947 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVSFQFLYEDGEGFHFMNPSSYDQVVVDVDTMGDDKAYLQEGMSCILSMHEGIALALQLPRHVTLEIMETEPVVKGQTASSSYKPAILSNGVRAMVPPHINAGTRVVIATEDNSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.014 kDa

MVKVIASSVRKGNVLDVDGKLYVVLTAQNFHPGKGTPVTQVDMRRIVDGVKVSERWRTTEQVERAFVEDVSFQYLYEDGEGFHFMNPGNYDQVVVDVETMGDQKAYLQEGMSCILSIHEGIPLALELPRHVTLEITETEPVVKGQTASSSYKPAMLSNGVRTMVPPHINAGTRVVIATEDNSYVERAKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.776 kDa

MATYSTNEFKSGLKVMLDGDPCSIVENEFVKPGKGQAFNRVKMKNLKSGRVWERTFKSGESLEGADVVDRDMQYLYNDGEFWHFMEPESFEQFQGDASVVGDSAKWLNEQDTVVVTLYNGSPLAVTPPNHVELEIVETDPGLKGDTAQGGTKPATLSTGAVVKVPLFLSTGETVRVDTRTGEYLGRANK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.925 kDa

MASYSTNEFKGGLKILIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELNAVYSYFDGDSYVFMHPETFEQYMVSQEALGETKKWLKDQDEYQIILFNGQPISIIAPNFVNLEIVETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.903 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.903 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.903 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.903 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.929 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAPNFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.903 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.903 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.903 kDa

MASYSTNEFKGGLKVLIDGNPMVIVENEFVKPGKGQAFNRVKLKNLLNDRVVEKTFKSGESVEAADVEELTTVYSYFDGDSYVFMHPETFEQYMVSEEALGETKKWLKDQDEYQVILFNGQPISIIAANFVNLEIIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQTGEIIKVDTRTSTYVSRVKD

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.138 kDa

MKTGKELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKLDDVILDRKEATLSFISGDTYTFMDTTDYTMYELNAEDIESVLPFVEEGMTDVCEAVFFEDRLVSVELPTTIVRQVDYTEGSARGDTSGKVMKPAKLKNGTELSVADFIEIGDMIEIDTREGGSYKGRAK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.334 kDa

MKTGKELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKLDDVILDRKEATLSFISGDSYTFMDTTDYTMYELNAEDIDAVLPYIEEGMEDICEAVFFEGRLVSVELPTTISRQVTYTENAARGDTSGKVMKPAKLKNGTEIQVADFIQIDEWIDIDTRDNSFKGRSKK

efp

Elongation factor P

189 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-35 is required for alleviation.

Belongs to the elongation factor P family.

22.05 kDa

MIIYYSANQSKSGLKILLKNEPCLILENQFVKPGKGQPFNRIKIKKLISGKIFTKIFKSNEKLIYADVLDVKVKSLYKDKKYWNFIKKENFEQFKISKKNLGEKYKWIIEQLECIVTFWDENPINITLPRFVDIKVCNANFDIKGDTIKSGNKYIILTTGAIIKAPIFIRSEEIVRVDTNLGEYVSRIK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.227 kDa

MINAQDIKNGTCIRMDGKLYFCIEFLHVKPGKGNTFMRTKLKDVVSGYVLERRFNIGEKLEDVRVERRPYQFLYKEGEDYIFMNQETFDQHPIAHDLINGVDFLLEGAVLDVVSDASTETVLYADMPIKVQMKVTYTEPGMKGDTATNTLKPATVESGATVRVPLFISEGETIEIDTRDGSYVGRVKA

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.125 kDa

MINAQDIKIGTAIRMDGKLYFCIDFLHVKPGKGNTFMRTKLKDVVNGYVLERRFNIGEKLEDVRVERRPHQYLYMEGADYIFMNQETFDQIPIAHDLINGVDFLLEGMVVDVVSDASTETVLFADVPVKVQMKITYTEPGLKGDTATNTLKPATVESGATVRVPLFINEGETIEIDTRDGSYVGRVKA

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.154 kDa

MYETSDFRKGLKIMLEGKPYVIVDFQHVKPGKGNQFTRTKLRNMLTGQNLESTFKSGEKFEVPNVENKEMSFLYKDDTGYNFMSQETFEQIAMSEEDLGEAKYYLTENLKVVILFYNEKAVACDVPKAVNLTVAQTDPGIKGDRVTGATKPATMETGLTVGVPLHINEGDVLRIDTSTGEYVERVSQK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.654 kDa

MAQTTNDIKNGSVLNLDGQLWTVMKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNAGMKMEFETVDNRTLQYSYEDGDNFVFMDMTTYDQIMVPKTLLGDKAKFLLEGTDCLVSFHDGTPLSVDLPGSVVLTITHTEPGLQGNRSNAGTKPATVETGAEIQVPLFINEGDRVKINTEDGSYTGRENN

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.654 kDa

MAQTTNDIKNGSVLNLDGQLWTVMKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNAGMKMEFETVDNRTLQYSYEDGDNFVFMDMTTYDQIMVPKTLLGDKAKFLLEGTDCLVSFHDGTPLSVDLPGSVVLTITHTEPGLQGNRSNAGTKPATVETGAEIQVPLFINEGDRVKINTEDGSYTGRENN

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.654 kDa

MAQTTNDIKNGSVLNLDGQLWTVMKFQHVKPGKGPAFVRTTIKNVLSGKIVDKTFNAGMKMEFETVDNRTLQYSYEDGDNFVFMDMTTYDQIMVPKTLLGDKAKFLLEGTDCLVSFHDGTPLSVDLPGSVVLTITHTEPGLQGNRSNAGTKPATVETGAEIQVPLFINEGDRVKINTEDGSYTGRENN

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.447 kDa

MVLYNINEFRTGLKIIQNREPCVIISHESIKPGKGQAFSRVRFRQIISGKILEKTFKSGDFLESANIMEIRLVYVYHDNEFWYFMDEKNFEEIAVAAKIIGTNIKWITTQLHYIVTLWNKVPILVTPPDSIELKIIKITPIKKNSTGSSGIKLATVSTGAIVKVPFFIQLGELIKINTRSGIYISRAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.659 kDa

MATYYSNDFRAGLKIMMDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFYHFMNNTTFEQLSADEKAVGENAKWLLDQAECIVTLWNGQPISVTPPNFVELEIIETDPGLKGDTAGTGGKPAKLSTGAVVKVPLFVQTGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.679 kDa

MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSAEGADVVDTNLNYLYNDGDFYHFMHPETFEQHPVEAKTVGDAAKWLLDNAECIVTLWNGKPIQVLPPNFVELEITDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSAEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.042 kDa

MVSVNDLKTGLTIKTSDGMIWQVLEFQHVKPGKGAAFVRTKMRNIRNGNIQEMTFRGGERVERAHIERNKMQYLYPMGETYVFMDTESYEQLELTTAQVEAALPFLLENMEVQIAIYNGEVLGIELPNTIVMTIVEAEPGVKGDTASNVKKNATVETGHIIHVPLFIEAGEKVTVDTRTGDFTGRYNG

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.919 kDa

MVSVNDLKTGLTVKTSDGSIWQVIEFQHVKPGKGAAFVRTKMRNLRNGAIQETTFRGGEKIERAHIERKRMQYLYPMGDTYVFMDNESYEQLELTSAQVKSALPYLLENMEVSIADYEGEILGIELPTSVVLTIVEADPGVKGDTASNVKKNATVETGHVIQVPLFIEPGEKVTVDTRTGEFMGRYNG

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.75 kDa

MASTSDIRNGLCIKFNHDIYKIIEFLHVKPGKGPAFVRTKLKSLTSGKVLDNTFSAGHKIDVIRVETHTFQFLYPEGDEFHFMNAETFEQISLNKNILDAPDLLKEGTNVMVQINTETDLPLSVDMPASVILEVTYAEPGVKGNTATNATKNATVETGANVNVPLFINEGDKIKIDTASGSYMERVKE

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.849 kDa

MATYSSNDFRSGLKIIFESEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSLEGADVVDTNMNYLYNDGEFYHFMHPETFEQHQVEEKTVGDSAKWLQDNAECIVTLWDGRPITVLPPNFIEAEITDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVVRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.754 kDa

MATYSSNDFRSGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSAEGADVVDTNMNYLYNDGEFYHFMHPETFEQHQVEEKTVGDSAKWLQDNAECIVTLWDGRAIAVQPPNFIEAEITDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVVRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.961 kDa

MISISNVSKGAIIRFKGEPHSIESLMHRTPGNLRAFYQANMRNLKSGRNVEYRFSATESVDVIITERKQYQYLYRDGSDFVMMDSETFDQINVPEIAIGSASRFVKDGITVTIVFSDDASILGVELPTFVEVEVTETSPASKDDRATSGTKPAMVETGTEVSVPMFIQTGSIIRVDTRTGEYIERVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.735 kDa

MKVSASSLRKGNVVDLDGKLYVVLSAQNIHPGKGTPVTQLDMRRISDGVKVSERYRTTETVERATVDDRDYTFLYEDGEGFHFMNPESYEQVTASAEMIGDAKYYLTDGCTVKLSTHEGVPIAIELPRLATFEVVDTEPTVKGQTASSSYKPAVLSNGLRTMIPPYITVGTKIVVLTEDGSYQERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.701 kDa

MATYSTNEFRSGLKIMLDGEPCAILESEFVKPGKGQAFARVRIRKLISGKLLEKTFKSTDSVESADVMDMNLTYLYNDGEFWHFMNNETFEQLAADEKAVGDNAKWLVEQAECILTLWNGQPISVTPPNFVELEITDTDPGLKGDTAGTGGKPATLNTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.683 kDa

MASFSTNEFRSGMKIMLDNEPCVIIENEFVKPGKGQAFSRVKIRKLLSGKVLEKTFKSGESVEAADVVEVELDYLYNDGEFYHFMDNVSFEQIAADVKAVGDNAKWLVENNTCTLTLWNGNPIIVTPPNFVELEVTETDPGLKGDTQGTGGKPATLITGAVVRVPLFIQIGEVIKADTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.717 kDa

MISTNDFKTGQTIKFNNNLFQIVSFLHVKPGKGAAFVRCKLKNLRTGSIIDNTFNSGIKVELAFINKNKIQFLYIDGNKYIFINIANYEQIEIEKQKIKNKIKYLYEGIIVDVVIYNDYEILDINLPEKLNLTVTKTEFIEKKDVKTNYYKDATLETGLVIKVPLFIQQGEKIIVNTQTGLYVSRCNK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.232 kDa

MTSISNISKGSIIRFRNEPHIIESLVHRTPGNLRAFYQAGMKNLKTGRNVEYRFSANESVDLIVTERKQYQYLYRDAEDFVMMDTSTFDQINVAAEIIGLPARFLKEGDLVDIVFADDGSILEAELPTFVELEVTETNPATKDDRATSGSKPAILETGAEVNVPMFIQTESIIRVDTRTGEYMERVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.095 kDa

MATIGMGDIKKNIRLIIGEVPCKVIEFQHVKPGKGAAFVRMKAKSFLNGRVFEKTVHAGDKFEVPEITFKTMQYLYDDGEQYQFMDNDSYEQIGLSYEQCDDASKWFKDGIQVDMIFYKGNAISVSAPEVMELLITDTPPNFKGDTSSGSKKPATLETGAVVQVPYHVLEGDTIRVNTVDCEYLEKVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.86 kDa

MATIGMGDIKKGVRLELDGNPYKVTEFQHVKPGKGAAFVRVKIKNLKTGKVIEKTVHAGDKFEVPELEQKTMQYLYDDGEMLQFMDTTTFDQIGLTHEQVGKETFDFMIDGMEADILFHNGEAISVEIPQTVVLKIVETPPNFKGDSQGGKKPATLESGAVVQVPFHVLEGEMIKVDTVEGKYLEKAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.295 kDa

MNLGITEVKKGMILKIDNELYSVVKTEFVNPGKGSAFIRTKLKNIVRDSSIERTFKAAEKLESVDLERRKMQYCYADGDQIIFMDVNDYEQIPVSKDYVEDILPFMKEETPVEVAFYNDKPIGVTPPNFAILEVTYAEDGLKGDTTGLALKRVTVETGGEVQVPIFIKQGDTVKIDLRDLSYVERVNK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.144 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTKNSSIERTFKAAEKLESVELEKRNMTICYTEGNDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRVTVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSR

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.144 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTKNSSIERTFKAAEKLESVELEKRNMTICYTEGNDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRVTVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSR

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.295 kDa

MNLGITEVKKGMILKIDNELYSVVKTEFVNPGKGSAFIRTKLKNIVRDSSIERTFKAAEKLESVDLERRKMQYCYADGDQIIFMDVNDYEQIPVSKDYVEDILPFMKEETPVEVAFYNDKPIGVTPPNFAILEVTYAEDGLKGDTTGLALKRVTVETGGEVQVPIFIKQGDTVKIDLRDLSYVERVNK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.159 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEKLESVELEKRNMTICYTEGDDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRITVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.159 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEKLESVELEKRNMTICYTEGDDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRITVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.295 kDa

MNLGITEVKKGMILKIDNELYSVVKTEFVNPGKGSAFIRTKLKNIVRDSSIERTFKAAEKLESVDLERRKMQYCYADGDQIIFMDVNDYEQIPVSKDYVEDILPFMKEETPVEVAFYNDKPIGVTPPNFAILEVTYAEDGLKGDTTGLALKRVTVETGGEVQVPIFIKQGDTVKIDLRDLSYVERVNK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.144 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTKNSSIERTFKAAEKLESVELEKRNMTICYTEGNDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRVTVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSR

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.144 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTKNSSIERTFKAAEKLESVELEKRNMTICYTEGNDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRVTVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSR

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.295 kDa

MNLGITEVKKGMILKIDNELYSVVKTEFVNPGKGSAFIRTKLKNIVRDSSIERTFKAAEKLESVDLERRKMQYCYADGDQIIFMDVNDYEQIPVSKDYVEDILPFMKEETPVEVAFYNDKPIGVTPPNFAILEVTYAEDGLKGDTTGLALKRVTVETGGEVQVPIFIKQGDTVKIDLRDLSYVERVNK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.159 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEKLESVELEKRNMTICYTEGDDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRITVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.159 kDa

MTLGITEVKKGMVLKVEGDLYSVVKTEFVNPGKGSAFIRTKLKNLTRNSSIERTFKAAEKLESVELEKRNMTICYTEGDDIIFMDSNDFEQMPVSKEYVEDILPFLKEETPMEVTFYEGKPIGVIPPNFSILEVTYAEEGLKGDTSGTAQKRITVETGGEINVPIFVKQGDVIKIDLRDLTYVERVSK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.65 kDa

MASVSTNEFKGGLKFMLDNEPCSIIENEYVKPGKGQAFNRVKLRRLLSGKTLEKTFKSGESFELADVVDVELDYLYNDGEFYHFMNSVSFEQIAADVKAVGDTAKWLVENDTCTLTLWNDNPITVTPPNFVELEVTETDPGLKGDTQGTGGKPATLSTGAVVRVPLFIAIGEVVKVDTRTGEYVGRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.906 kDa

MAERGSDIRPGQILDHNGSLYLVVKTMHTQPGKGGAYIQAELKNLKTGAKYQERFRSDGYVKRAIVEEVEYQYIFGDGALLTLMNTATYEQVSISADMLGEKGVYLKEGIILTLSFYQGQVVAARVPDYVVLEVVETESVIKGQTASSSYKSAVLENGERISVPPFIKVGERIVVYTVDDTYYERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.88 kDa

MAERGSDIRPGQILDHNGSLYLVVKTMHTQPGKGGAYIQAELKNLKTGAKYQERFRSDGYVKRAIVEEVEYQYIFGDGASLTLMNTATYEQVSISADMLGEKGVYLKEGIILTLSFYQGQVVAARVPDYVVLEVVETESVIKGQTASSSYKSAVLENGERISVPPFIKVGERIVVYTVDDTYYERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.028 kDa

MAERGNDIRPGQVLDHNGALYLVVKTMHTQPGKGGAYIQAELKNLKTGAKYQERFRADGYVNRAIIEEVSFQYIFGDSSSLTLMNTENYEQISIPVELLGDKSVYLQENMILTLLFHKGQVISAKVPDYVVLEVVEAESVIKGQTASSSYKSAVLENGRRVSVPPFIKVGEKIVIYTPDDTYYERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.588 kDa

MKTAQEFRAGQVAMINGEPWVIQKAEFNKSGRNAAVVKMKLKNLLNGQATETVYKADDKFEPVILERKEVTYSYFADPMYVFMDNEFNQYEIEKDDLGDAYNFIEDGMQDVCEAVFYNDRVISIELPTTIVRQISYTEPAVRGDTSGKVMKVARLNSGYELRVAEFCDIGDYIEIDTRTFEYKSRAKA

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.065 kDa

MKIAQECRAGNVVMIDGSPWVVQKAEYNKSGRNAAVVKMKLKNLLSGINTETVYKADDKFEDILLDRKEVTYSYYADPMYVFMDGEYNQYEVTKEDLGDLLPWIEDGMEDVCDAVFYEGKVISVTAPTSIVREIAYTEPAVRGDTSGKVMKVAKLKNGTELSVAAFVEIGEKIIIDTRTGEYKSRAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.049 kDa

MPSISTVSKGSIIRFKGEPHSIESLIHRTPGNLRAFYQANMKNLKTGRNVEYRFSSSETVDVIVTERKQYQYLYRDGSDFVMMDNNTFEQINVPEVALGEGANFMKDNINVTIVFSDDGSILQVELPTFVEVEVTDTNPASKDDRATSGTKPAIVETGAEVNVPMFIQIGSVIRVDTRTGEYIERVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.101 kDa

MTSISNVSKGSIIRFKGEPHIIESLVHRTPGNLRAFYQANMKNLKTGRNVEYRFSASESVDLIVTERKQYQYLYRDGNDYVMMDNDTFDQINVQELSIGPSARFLKDGINVTIIFSDDGSILDVELPTFVEVEVMETSPATKDDRATSGTKPATVETGAEVSVPMFIQCGSVIRVDTRTGEYIERVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.122 kDa

MVSISNVSKGAIIRWKGEPHSIESLVHRTPGNLRAFYQASMKNLKTGRNVEYRFSATEQVDVIVTERKKYQYLYRDGEDYVMMDTETFDQINVPEVAIGSASRFIKDAVMVDIVFADDGSILEVELPTFVELEVTETNPASKDDRATSGTKPAIVETGAEVNVPMFIQTGSIIRIDTRSGEYMDRVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.898 kDa

MTSISNVSKGSIIRFKGEPHIIESLIHRTPGNLRAFYQANMKNLKTGRNVEFRFSASESVDVIVTERKPYQYLYKDGTDFVMMDSGTFDQINVPEITLGTSSRFLKDGITVVIVFSDDGSILDVEMPTFVEVEVTETSPTTKDDRATSGTKPAIVETGAEVGVPMFIQTGSIIRVDTRTGEYIERVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.774 kDa

MTSISNVSKGAIIRFKGEPHIVESLVHRTPGNLRAFYQANMRNLKSGRNVEYRFSATESVDVIITERKEYQYLYMDGADYVMMDSTTFDQINVSEAAIGSGSRFIKDGITLTIVFSDDGAILSVELPTFVEVEVTETSPASKDDRATSGTKPAIVETGAEVNVPMFVQNGSVIRVDTRSGDYIERVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.402 kDa

MATTSDLAKGVILRFNGNLHILEEISHHTPGNKRGFYQAKMRNLRNGRIVENKFRSGEAVEIVSTERRKHQYLYQDGLDYVMMDGDTYEQLHISNELIGEQAKFLKESMEVDLVFTTDGEIIQAEVPVFVELEVTETDPTTKDDRANSGTKPATMETGAIIQVPMFVQNGDFIRIDTRTGEYIERAKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.091 kDa

MVSISNVSRGAIIRWNGAPHSIESLVHRTPGNLRAFYQASMKNLKTGRNVEYRFSATEQVDVIVTERKKYQYLYRDGEDYVMMDTETFDQINVPEVAIGPASRFLKDSVMVDIVFADDGSILEVELPTFVELEVTETSPASKDDRATSGTKPAIVETGAEVNVPMFIQTGSIIRIDTRSGEYMERVKK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.846 kDa

MATYSTNEFKGGLKVMLDGDPCSILENEFVKPGKGQAFSRVKLRNLITGRVWERTFKSGESLEGADVLELDMEYLYSDGDMWHFMRTDGSFEQYAVDKKAMGDVEKWLKEQVVYTVTLWNDNAIAVSAPNFIELEVVETDPGLKGDTAQGGSKPATLSSGAVVRVPLFINEGEVLKVDTRTGEYVSRA

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.578 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDSAKWLLDQAECIVTLWNGQPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.253 kDa

MASIIHAKDLRSGHTFTLDGKIYLVIENSFNKTAMREGIVKCKVKNLRTGSITTEVLTGMKLEQANIEKVKMSFVYQDQNSFVFMNNETYEQIEVPAKLLEYEKNFITENTEALIMRYEDEILGVNLPDQVVIEIDYAEDAVQGNSVNNALKKATLVTGYVIEVPQFIKSKEKVIVSTVDGKYVSRAN

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.103 kDa

MVNVNNFKNGITFQEEDEIFSVIEAQHSKQGRGQASVKAKVKNLRTGAITIKSYTGGDKVKKAHIEKIEMNFLYDEGENIVLMDNATYEQISIPKTRVEWEMNFLVEGAKVHIRKFADEILDIEIPVNIELKVIDAPEAVKGNTSSNPQKKVKVETGFELETPLFIKEGEIIIVSSETGKYMGKGNNK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.227 kDa

MSQIIHAKDLRPGNTFIYKNNLYLVIENSFNKTAMREGIVKCKVKNLRTSSITVEVLTGEKLERAIIDKVKAMYSYADKNTLVFMDGESFEQIEIDANKLKWEKNFIVDGSEVSILKYGEEVLNVSLPDQVSLLVDFAEEAVQGNTVQTAMKKARLETGLEIEVPQFIKTGEKIIVNTVDGKYVGRDK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.59 kDa

MASYSTNEFRSGLKIMLDGEPCAIIENEFVKPGKGQAFNRVRLRKLVSGKVLEKTFKSGDSVEAADVMDINLTYLYNDGEFWHFMNNENFEQLAADAKVVGDNAKWLVEQAECVLTLWNGQPIAVTPPNFVELEITETDPGLKGDTAGTGGKPATLTTGAVVKVPLFVQIGEVIKVDTRSGDYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.261 kDa

MASTSDIRNGLCIRYNHDIYKITEFLHVKPGKGPAFVRTKLKSVTTGKVLDNTFSAGHKIEEIRVETHKFQFLYEDGEFWHFMNVEDYTQIRLTENALDMPKLIKEGEVVTILINTEDNMPLSVDMPASVVLEVTHTEPGVKGNTATNATKPATVETGFEVNVPLFINEGDKIKIETDKGTYKERIKE

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.684 kDa

MASYSTNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGTSVEAADVVDYNYTYSYKDEDFWYFMHPETFEQISVDAKALGDNDKWLVDQAECIITLWNGAAISVTPPNFVELAVVETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQIGEIIKVDTRSGEYISRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.612 kDa

MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAEKWLLDQADCIVTLWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.612 kDa

MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAEKWLLDQADCIVTLWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.598 kDa

MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAEKWLLDQADCVVTLWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.612 kDa

MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAEKWLLDQADCIVTLWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.758 kDa

MASYSTNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGSTVEAADVVDYNYTYSYKDEDFWYFMHPETFEQISVDSKALGDNDKWLVDQAECIITLWNGSAIGVTPPNFVELEVIETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQIGEVIRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.626 kDa

MATYTTSDFKPGLKFMQDGEPCVIIENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDEAFWYFMHPETFEQYSADAKAVGDAEKWLLDQADCIVTLWNGAPITITPPNFVELEVVETDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.612 kDa

MATYSSNEFRSGLKIMLDGEPCSIIESEFVKPGKGQAFVRTRIRKLISGKLLEKTFKSTDSVEGADVVDMNLIYLYNDGDFWHFMNNDTFEQLAADVKATGESAKWLVEQAECILTLWNGQPISVTPPNFVELQIVDTDPGLKGDTAGTGGKPATLTTGAVVKVPLFVQIGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.675 kDa

MKVNANTMRKGHILEDGGKLYVITAANIVQPGKGGAFIQLEMKDVRTGTKTSMRFRTQETVERARLDEHEMSFLFAEGDQYTFMDKESFEQVTIPGDVIGDGKVFLQDGMEVVVQSFEGAPLSVELPQTVTLRIVEADPVVKGQTASSSYKPAVLENGVRVLVPPHVDAGTRIVVNVEDGTYLERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.655 kDa

MRVIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKATIEERNYSFLYEDGEGFHFMEPESFDQVQVTKDVVGNSAPYLQEGMVVKLSMHDTVAVAITLPQRATLEVVETEPVTKGQTASSSYKPAVLSNGVRTAVPPHVGVGTRIVVLTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.656 kDa

MRVIASSIRKGNVIEQDGKLYVVLTAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKATIEDSNFTFLYEDADGFHFMNPESFDQVQVPKEVVGNAAPYLAENMSVKLSMHDTTPVAIQLPQRATLEVVDTEPVTKGQTASSSYKPAMLSNGVRTAVPPHIGVGTRIVVMTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.717 kDa

MRVIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVEKVTIEERNYSFLYEDGEGFHFMEPESYDQVQVTKDVVGSAAPYLQEGMVVKLSMHDTTAVAITLPQRATLEVVDTEPVTKGQTASSSYKPAVLSNGVRTQVPPHIGTGTRIVVLTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.657 kDa

MRVIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKVSERYKTTDQVEKATIEERNYTFLYEDGEGFHFMEPESFDQVQVTKDVVGNSAPYLAENMVVKLSMHDTTAVAITLPQRATLEVVETEPVTKGQTASSSYKPAILSNGVRTAVPPHVGVGTRVVVLTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.726 kDa

MRVIASSIRKGNVLEQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDHVEKVTIEERNYSFLYEDGEGFHFMEPESYDQVQVTKDVVGSAAPYLQEGMVVKLSMHDTTAVAITLPQRATLEVVDTEPVTKGQTASSSYKPAVLSNGVRTQVPPHIGTGTRIVVLTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.032 kDa

MKVIASSLRKGNVVDIDGRLYVVLTAQNFHPGKGTPVTQVDMRRISDGTKVSERWKTTEQVERATVDEREYDFLYEDGEGYHFMEPVSYDQVVVSPDVVGDGKVFLTEGMRVYLQTHNDVAISIEFPQKVTVEITETEPVVKGQTASSSYKPAMCTNGLRVMVPPHISAGTRIVINTEDLSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.458 kDa

MKISANSIRTGNILVYNNDLWVVSKTPEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSANYLEKAELEQKDYQFLYFEGDDLVLMDTKHFDQINISKEMLEEKLSFLTENMIVKVEFYNDKPLNIELPPTVILEISETDPVIKGATATASYKPAILENGIKVKVPQYLEIGEKIVVKTDDMTYVERAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.266 kDa

MKISANSIRTGNILVCNNDLWVVSKTPEHTQPGKGGAYVQVEMKNLKTGIKRNDRFSSSDYLEKAELEQKDYQFLYFEGNDLILMDTKHFDQINVPKGILEEKLPFLTENMIVKVEFYNEKPLNIELPPTVILEISETDPVIKGATATASYKPAVLENGIKVKVPQYLAIGEKIVVKTDDITYVERAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.401 kDa

MKISANSIRTGNILVYNNDLWVVSKQPEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSSDHLEKAELEQKDYQFLYFEDNNIVLMDNQTFEQISVNKEILDEKLPFLTENMIVKVEFYNEKPLSIELPATVILEIIETDPVIKGATATASYKPATLANGVKVKVPQYLEIGEKIVVKTEDLTYVERSK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.401 kDa

MKISANSIRTGNILVYNNDLWVVSKQPEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSSDHLEKAELEQKDYQFLYFEDNNIVLMDNQTFEQISVNKEILDEKLPFLTENMIVKVEFYNEKPLSIELPATVILEIIETDPVIKGATATASYKPATLANGVKVKVPQYLEIGEKIVVKTEDLTYVERSK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.431 kDa

MKISANSIRTGNILVYSNDLWVVSRTPEHTQPGKGGAYVQVEMKNLKTGTKRNERFSSSDYLEKAELEQKDYQFLYFEGNDLVLMDIKHFDQINVPKEILEEKLPFLAENMIVKVEFYNEKPLNIELPPTVIIEISETDPVIKGATATASYKPAILTNGIKVKVPQYLEIGEKIVVKTDDMTYVERAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.019 kDa

MATHSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYSYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGVRGDTATGGTKRAKLETGAVVRVPLFLNEGEIIKVDTRRGEYVSRAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.045 kDa

MATHSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGVRGDTATGGTKRAKLETGAVVRVPLFLNEGEIIKVDTRRGEYVSRAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.045 kDa

MATHSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGVRGDTATGGTKRAKLETGAVVRVPLFLNEGEIIKVDTRRGEYVSRAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.045 kDa

MATHSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGVRGDTATGGTKRAKLETGAVVRVPLFLNEGEIIKVDTRRGEYVSRAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

21.045 kDa

MATHSTNEFRGGLKVMVDGDPCSIIDNEFVKPGKGQAFNRVKFRNLKTGRVLERTFKSGETLPAADVVEVEMQYLYNDGEFWHFMTSENYEQHAASKEAVAEAKQWLKEEALCMVTMWNGVPLSVEPPNFVELKITETEPGVRGDTATGGTKRAKLETGAVVRVPLFLNEGEIIKVDTRRGEYVSRAK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.505 kDa

MATYSSNDFRAGLKIMMDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGSRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLAADAKAVGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.145 kDa

MITSNDFKNGMTIEVDGEVYSIVEFQHVKPGKGAAFVRTKLRHMKSGNVSEKTFRAGEKVKRAHLEEREMQFLYAAGDMYNFMDTESFEQYTLTKDQLEDKTQFIKENMIITVLFHNGEEISIELPVFVELAVSETEPGVKGDTASGGSKPATLETGATVNVPFFINEGDIIKVDTRTSEYIERVKGE

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.86 kDa

MRVIASSIRKGNVIEQDGKLYVVLTAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVERATIEDHNFTFLYEDADGFHFMNAENYDQVQVPKDVVGNVAPYLQENMVVKLSLHEMVPVAITLPQRVTLEVVETEPVTKGQTASSSYKPAMLSNGVRTGVPPHVAVGTRIVVMTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.591 kDa

MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.894 kDa

MKQQANLIRAGQVIEHDGRRWTVLKQQIITPGKGGAFIQVEMRDLKTGNKTNERWRTADTVERLMTDNRDYTYSYTDGDNLVLMDGETFEQFLVPAELLGDQAPFLQDNMAVIVDLVEGDPVGIHLPATVTLEIVEADPVVKGQTASSSYKPAKLSNGVKVMVPPFIEAGERIVVRTEDSTYVERAKG

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.816 kDa

MASYSTNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGTSVEAADVVDYNYTYSYKDEDFWYFMHPETFEQISVDEKALGDNDKWLVDQAECIITLWNGSAISVTPPNFVELEVVETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQIGEVIRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.816 kDa

MASYSTNDFKPGLKFIQDGEPCVIVENEFVKPGKGQAFTRTKIRKLISGKVLEINFKSGTSVEAADVVDYNYTYSYKDEDFWYFMHPETFEQISVDEKALGDNDKWLVDQAECIITLWNGSAISVTPPNFVELEVVETDPGLKGDTAGTGGKPATLSTGAVVRVPLFVQIGEVIRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.684 kDa

MASYTTTDFKPGLKFMQDGEPCVIIENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLNYSYKDEAFWYFMHPETFEQYSADAKAVGEAEKWLLDQAECIVTLWNGSPISVTPPNFVELEVVDTDPGLKGDTAGTGGKPATLSTGAVVRVPLFIQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.126 kDa

MKTAQEIRAGNVVMIGTEPMVVQKAEFNKSGRNSAVVKMKLKGLLNGSATETVFKADDKLEVVQLERKECTYSYFSDPLYVFMDTEYNQYDVEKDNLGDALNYMVDGMEDICEVTFYNEKAISVELPTTIVREVEYTEPAARGDTSGKVTKPARLKGTTYELAVAAFVEIGDKIEIDTRTGEFKRRVN

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.065 kDa

MKTAQEIRAGNVVMIGTEPMVVQKAEFNKSGRNSAVVKMKLKGLLNGSATETVFKADDKLDVVQLERKECTYSYFSDPLYVFMDTEYNQYDVEKDNLGDVLNYLVDGMEDICEVTFYNEKAISVELPTTIVREVEYTEPAARGDTSGKVTKPARLKGTAYELAVAAFVEIGDKIEIDSRTGEFKRRLS

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.949 kDa

MKINANLIRPGNILEHNGRQYAVLKTQIVQPGKGGAFITVEMRDIRTGNKTNERWRTADTIEKCNVEAKECTFLFKDDSNMTFMDSESFEQFTMPNDTLGDTIGFLQDGMVVEVDFVEGSPVSITLPEKVVMKVVEADPVVKGQTASSSYKPAKLENGMKILVPPFLEEGEVIIVNTTDCSYVERFKG

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.853 kDa

MKINGNEIRPGNVLMHQDTLWVAVKTDHVKPGKGGAFAQVELKNLLDGRKLNERFRAADKVEKVRLEQKDYTFLFASDDMLTFMDAETYEQIELQTDFVGEERASYLTDGMTVVVESHEERPIGISLPQHVTLEVADTEPVVKGQTAANSYKPAILSNGVRSSVPPFVGVGEKIIVATEDGSYVKRAD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.743 kDa

MKVIASTLRKGNVVDKDGKLYVILTAENIHPGKGTPVTQLDMRRITDGVKISERYRTTEQVERAFVEDRDHTFLYQDGEGYHFMNPESYEQIAVPADVVGDAAPYLQEGMTVTLSTHNGVPLTIELPQRMTFEIVETEPVTKGQTASSSYKPALLSNGVKTSVPPHVSTGTRVVIMTADGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.764 kDa

MAIVSTSEFKNGLKVMLDGDPCTMLESEFVKPGKGQAFNRVKLRNLKTGRVVERTFKSGETLETADVVDVEMQYLYNDGELWHFMVPESFEQYAADQNAVADAKKWLKEQDICILTLFNNVPLAVQPPNFVELTITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVQTGEVIKVDTRTGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.748 kDa

MKVIASSLRKGNVVEKDGRLYVILSAENIHPGKGTPVTQLDMRRITDGVKVSERYRTTEQVERAFVEDREHTFLYSDGEGFHFMNPESYEQVAVPEDVIGDQAAYLQEGMAVMLSLHNGVPLAIELPQRVTLEVTETEPVTKGQTASSSYKPATLSNGVRTQVPPHITAGTRVVIMTADGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.742 kDa

MKVIASTLRKGNVVDKDGKLYVILTAENIHPGKGTPVTQLDMRRITDGVKISERYRTTEQVERAFVEDRDHTFLYQDGEGYHFMNPENYEQLAVPEDVVGDAAPYLQEGMVVTLSTHNGVPLAIELPQRVTLEIVETEPVTKGQTASSSYKPAILSNGVKTSVPPHITTGTRVVIMTADGAYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.717 kDa

MKVIASTLRKGNVVEKDGKLYVILFAENIHPGKGTPVTQLDMRRITDGVKVSERYRTTEQVERAFVEDREHTFLYSDGEGFHFMNPENYEQIAVPEDVVGDAAPYLQEGMAVMLSVHNGVPLTIELPQRVTLEVAETEPVLKGQTASSSYKPATLSNGVRTTVPPHIAAGTRVVVMTADGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.741 kDa

MKVIASSLRKGNVVEKDGRLYVILSAENIHPGKGTPVTQLDMRRITDGVKVSERYRTTEQVERAFVEDREHTFLYKDGEGSHFMNPESYEQVAVPDDVIGDQAAYLQEGMAVMLSLHNGVPLAIELPQRVTLEIVETEPVTKGQTASSSYKPAVLSNGVRTLVPPHITTGTRVVIMTADGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.623 kDa

MATYYSNDFRSGLKIMLDGEPYAVESSEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDSAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNGQPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.765 kDa

MATYSSNDFRPGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRRLLTGSRVEKTFKSTDSCEGADVVDTNMNYLYNDGEFYHFMHPETFEQHGVEEKTVSDAAKWLQDNAECIVTLWDGRPIAVQPPNFIEAEITDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVVRVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.185 kDa

MKTAHEIRPGNVIMFNDSPWVVQKTETTRSGRNAAIVKMKLKNLLIDSSTETTFKGEDKMDVIVLERLDCTYSYFADPMYVFMDSEYNQYDVEAENVGDAAKYIVDGMEETCQVTFYEGKAISVEMPTTIIREVGYTEPAARGDTSGKVMKPAKLVGSDIELMVADFVKEGDKIEIDTRTGEFKKRVN

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.343 kDa

MAERANDIRPGQVLEHNGGLFSVISIMHTQPGKGGAYIQAEMKNIQTGAKYYERFRSDATIRRAILDEEEYVYLFTEGNIVNLMHPSSYEQIVINLDLLGEKKAYLQDNMKIKVVTYQDKIISAHVPDHVTLTVKETESVIKGQTVTASYKPAILENGIRVNVPQFIKEGDKIVLHTPDNSYYERVKE

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.813 kDa

MAERANDIRPGQVLEHNGGLFLVVSIMHTQPGKGGAYIQAEMKNIKTGAKLYERFRSDATIRRAILDEEEYIYLFTEGNIVNLMHPSNYEQITINLDLLEEKKIYLQDNMRIKVVTYQDKIIFAHVPDYVRLTVKETESFIKGQTITSSYKPAVLENGMRINVPQFIKEEDKIVVYTPDDSYYERVKE

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.411 kDa

MAERANDIRPGQVLEHNGGLFLVVGIMHTQPGKGGAYIQAEMKNIKTGAKHYERFRSDATIRRAILDEEEYVYLFTEGNIVNLMHPSNYEQITINLDLLGEKKIYLQDNMKIKVVAYQDKIISAHVPDYVTLAVKETESVIKGQTATASYKPAILENGMRVNVPQFIKEEDKIVVYTPDDSYYERVKE

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.88 kDa

MATVGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKATDDVEVADVVDTDMRYLYSDGEYWHFMDPDTFEQVQTDKAGMGGADKWLKGEEDCIVTLWNGTPIWVQPPNFVELKITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVNQDEIIKVDTRSGEYSARVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.894 kDa

MATVGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKATDDVEVADVVDTDMRYLYSDGEYWHFMDPETFEQVQTDKAGMGGADKWLKGEEDCIVTLWNGTPIWVQPPNFVELKITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVNQDEIIKVDTRSGEYSARVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.834 kDa

MATVGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKATDDVEVADVVDTDMRYLYTDGEYWHFMDPESFEQVQADKAGMGGAEKWLKGEEDCIVTLWNGAPIWVQPPNFVELKITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVNQDEVIKVDTRSGEYSARVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.834 kDa

MATVGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKATDDVEVADVVDTDMRYLYTDGEYWHFMDPESFEQVQADKAGMGGAEKWLKGEEDCIVTLWNGAPIWVQPPNFVELKITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVNQDEVIKVDTRSGEYSARVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.834 kDa

MATVGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKATDDVEVADVVDTDMRYLYTDGEYWHFMDPESFEQVQADKAGMGGAEKWLKGEEDCIVTLWNGAPIWVQPPNFVELKITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVNQDEVIKVDTRSGEYSARVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.864 kDa

MATVGMNDVKNGMKILVNNEPAVITETEYVKPGKGQAFTRMKYRFIKSGRVVEMTMKATDDVEVADVVDTDMRYLYSDGEYWHFMDPETFEQVQTDKAGMGGADKWLKGEEDCIVTLWNGAPIWVQPPNFVELKITETDPGVRGDTSGGGGKPATLETGAVVRVPLFVNQDEIIKVDTRSGEYSARVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.744 kDa

MASYGMNDVKNGMKILVNAEPAVITDTEYVKPGKGQAFTRVKYRLIKSGRVQEVTMKSTDTLEAADVVDTDMQYLYSDGEYWHFMQQETFEQVQADKNGMGGAEKWLKGEEQCVVTLWNGVPIGVQPPNFVELKITETDPGLRGDTSGGGGKPATLETGAVVRVPLFVNQDEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.744 kDa

MASYGMNDVKNGMKILVNAEPAVITDTEYVKPGKGQAFTRVKYRLIKSGRVQEVTMKSTDTLEAADVVDTDMQYLYSDGEYWHFMQQETFEQVQADKNGMGGAEKWLKGEEQCVVTLWNGVPIGVQPPNFVELKITETDPGLRGDTSGGGGKPATLETGAVVRVPLFVNQDEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.744 kDa

MASYGMNDVKNGMKILVNAEPAVITDTEYVKPGKGQAFTRVKYRLIKSGRVQEVTMKSTDTLEAADVVDTDMQYLYSDGEYWHFMQQETFEQVQADKNGMGGAEKWLKGEEQCVVTLWNGVPIGVQPPNFVELKITETDPGLRGDTSGGGGKPATLETGAVVRVPLFVNQDEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.737 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDLNLTYLYNDGEFWHFMNNETYEQLQADAKAIGDNAKWLIDQAECIVTLWNGQPISVTPPNFIELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.711 kDa

MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRRLLTGGRVEKTFKSTDSLEGADVNDMNLTYLYNDGEFWHFMNNETYEQLQADAKAVGDNGKWLIDQAECIVTLWNGQPIAVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQVGEIIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.225 kDa

MINAQDIKNGTCIRMDGKLYFCIEFLHVKPGKGNTFMRTKLKDVVSGYVLERRFNIGEKLEDVRVERRPYQYLYKEGEDYIFMNQETFDQHPIAHDLINGVDFLLEGAVVEVVSDASTETVLYADMPIKVQMKVTYTEPGLKGDTATNTLKPATVESGATVRVPLFISEGETIEIDTRDGSYVGRVKA

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (By similarity).

Belongs to the elongation factor P family.

21.225 kDa

MINAQDIKNGTCIRMDGKLYFCIEFLHVKPGKGNTFMRTKLKDVVSGYVLERRFNIGEKLEDVRVERRPYQYLYKEGEDYIFMNQETFDQHPIAHDLINGVDFLLEGAVVEVVSDASTETVLYADMPIKVQMKVTYTEPGLKGDTATNTLKPATVESGATVRVPLFISEGETIEIDTRDGSYVGRVKA

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.513 kDa

MAKVLATEIRVGNLIEWDKRIWRVLKCYHVHVGGRGGAFMQVEMKDIEAGTKTNQRIRTEDKVERAFVEPREMTFLYQEGDNYIFMDKENYEQLSLSRDFLEGQYEYLLPNTDVQVNFHNDRAIGVQLPASVVLTITDTEPNLKGATATSSYKPATTETGLVVMVPPFVLQGERIKVNTDSGEYIERM

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.732 kDa

MRVIASSIRKGNVIEQDGKLYVVLTAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVERATIEDHNFTFLYEDGDGFHFMNAETYDQVQVPKDIVGSAAPYLQENMVVKLSLHDMVPVAITLPQRVTLEVVETEPVTKGQTASSSYKPAVLSNGVRTGVPPHVAVGTRVVVMTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.698 kDa

MRVIASSIRKGNIIDQDGKLYVVLSAENIHPGKGTPVSQIEMRRISDGVKISERYKTTDQVERAHVEDHDYNFLYADDDGFHFMNNESYEQLMVPKDVVGTAAPYLSENLTVKLAIHEGVAVAITLPQRITLEVVETEPVTKGQTASSSYKPAVLSNGVRSAVPPHIGVGTRIVVMTEDGSYVERAKD

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

21.244 kDa

MINSQDIKKGTCIRLDGKLYFCVDFLHVKPGKGNTIMRTTLKDVVKGGQIERRFNIGEKLEDVRVERRPYQFTYTEGEHYHFMNQETFDDVIIDKNLINGVDFMKEGEIVDVVSDASTDTVLFADMPTKVQLKVTYTEPGIKGDTATNTLKPATVETGAEVRVPLFINEGEVIEINTTDGSYVGRIRE

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.

20.598 kDa

MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAIGDAEKWLLDQADCIVTLWNGAPISVTPPNFVELEIIDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRSGEYVSRVK

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.621 kDa

MASTNDLKNGLVLKLDGGQLWSVVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVETATIDKRDMQFSYMDGEYFVFMDMDTYDQLMVDRKSVGDAANFLIEGFTATVAQHEGEVLFVELPAAVELVIQETEPGVQGDRSTGGTKPATLETGHQIQVPLFITTGEKIKVDTRTSDYLGRVNS

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.649 kDa

MASTNDLKNGLVLKLEGGQLWSVVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVETATVDKRDMQFSYMDGDYFVFMDMETYDQLMIDRKVVGDAANFLVEGFEATVAQHEGEVLFVELPAAVELTIQETEPGVQGDRSTGGTKPATLETGHQINVPLFITTGEKIKVDTRTSDYLGRVNS

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.

Belongs to the elongation factor P family.

20.529 kDa

MASTNDLKNGLVLKLDGGQLWSVVEFQHVKPGKGPAFVRTKLKNVLSGKVVDKTFNAGVKVDTATIDRRDMQFSYMDGEYFVFMDMDTYDQLMVDRKAVGDAANFLIEGFTASVAQHEGEVLYVELPAAVELTIQHTDPGVQGDRSTGGTKPATLETGYEIGVPLFITTGEKIKVDTRSGDYLGRVNS

efp

Elongation factor P

188 amino acids

Involved in peptide bond synthesis. Alleviates ribosome stalling that occurs when 3 or more consecutive Pro residues or the sequence PPG is present in a protein, possibly by augmenting the peptidyl transferase activity of the ribosome. Modification of Lys-34 is required for alleviation.

Belongs to the elongation factor P family.