About Services Proteins Contact

ectC

Gene
ectC
Protein
L-ectoine synthase
Organism
Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Length
138 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.996 kDa
Sequence
MIVRTLEECRQSERRVVAENWESVRMLLKDDHMGFSFHITTIYANTQTHIHYRNHLESVYCMSGEGEIEVVGGKTYPIQPGTLYILDQHDEHYLRAFSSEMVMACVFNPPLTGHEIHDAEGVYPLDKSELISQCHKEK

Gene
ectC
Protein
L-ectoine synthase
Organism
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Length
138 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.996 kDa
Sequence
MIVRTLEECRQSERRVVAENWESVRMLLKDDHMGFSFHITTIYANTQTHIHYRNHLESVYCMSGEGEIEVVGGKTYPIQPGTLYILDQHDEHYLRAFSSEMVMACVFNPPLTGHEIHDAEGVYPLDKSELISQCHKEK

Gene
ectC
Protein
L-ectoine synthase
Organism
Vibrio cholerae serotype O1 (strain M66-2)
Length
138 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.996 kDa
Sequence
MIVRTLEECRQSERRVVAENWESVRMLLKDDHMGFSFHITTIYANTQTHIHYRNHLESVYCMSGEGEIEVVGGKTYPIQPGTLYILDQHDEHYLRAFSSEMVMACVFNPPLTGHEIHDAEGVYPLDKSELISQCHKEK

Gene
ectC
Protein
L-ectoine synthase
Organism
Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Length
137 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.15 kDa
Sequence
MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVLVLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVTGREVHDESGAYPADPELAREPVAAD

Gene
ectC
Protein
L-ectoine synthase
Organism
Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
Length
137 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant. Does not act on N-acetylated amino acids like N-alpha-acetyl-L-asparagine,N-alpha-acetyl-L-ornithine, N-alpha-acetyl-L-lysine and N-epsilon-acetyl-L-lysine.
Similarity
Belongs to the ectoine synthase family.
Mass
15.458 kDa
Sequence
MIVRNLEEARQTDRLVTAENGNWDSTRLSLAEDGGNCSFHITRIFEGTETHIHYKHHFEAVYCIEGEGEVETLADGKIWPIKPGDIYILDQHDEHLLRASKTMHLACVFTPGLTGNEVHREDGSYAPADEADDQKPL

Gene
ectC
Protein
L-ectoine synthase
Organism
Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Length
135 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.387 kDa
Sequence
MIVRTLEEIEDTDADIKTENWRSKRIVLAREKVGFSVHETTLYAGTVNDFWYANHIEAVFVFEGEGEITDKATGETHQLKPGSLYLLNNHDKHQVRPKTDMRTVCVFNPPVTGREVHDENGVYPVIVEDEEEAAS

Gene
ectC
Protein
L-ectoine synthase
Organism
Hyphomonas neptunium (strain ATCC 15444)
Length
135 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.753 kDa
Sequence
MIVRDLAKEILTDRRVDSDGWSSVRLLLKDDGMGFSFHITTIHAGAELHMHYKNHLESVFCMEGTGSITDLATGETHEIRPGVMYALNKNDKHILRANAGAPMMMACVFNPPVTGKEVHGEDGAYPADAALENSA

Gene
ectC
Protein
L-ectoine synthase
Organism
Sporosarcina pasteurii
Length
134 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.086 kDa
Sequence
MIVRTIDEIIGTENEVESDTWTSRRLLLEKDGMGFSFHETIIYAGTETHIHYQNHLEAVYCVGGDGEIETVSDGKVYPIQDGTMYALDQHDEHYPRGGKTDMRLICTFNPPLVGTETHDENGVYPLLSKQPVGK

Gene
ectC
Protein
L-ectoine synthase
Organism
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Length
134 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.235 kDa
Sequence
MIVRSFKDIEGTDRHVKAASGTWESKRIVLAKEKVGFSLHETVLYAGTETSMWYANHIEAVLCVEGEAELTDDETGEKHWITPGTMYLLDGHERHTMRPKTDFRCVCVFNPPVTGREDHDENGVYPLLTEPEEV

Gene
ectC
Protein
L-ectoine synthase
Organism
Thermobifida fusca (strain YX)
Length
134 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.083 kDa
Sequence
MIVRSLDDINGTDADVVTENWRSRRIVLARDGVGFSFHETVLYAGTETSMWYANHIELVHCIEGEAEVTNDETGETFLITPGTLYLLNGHERHTVRPKTDFRVLCVFTPPVTGREVHDENGSYPLLTEDATDTD

Gene
ectC
Protein
L-ectoine synthase
Organism
Bacillus clausii (strain KSM-K16)
Length
134 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.321 kDa
Sequence
MKVVKLADIIGTNRDVDGGNWRSQRIVVESDGMGYSLHDTQIKAGTETHLWYKYHLESVYVIEGEGEVETVKDGKVWPVKQYECYVLDKNDEHLLRAKTDMRMVCVFNPPVTGEEVHDEDGAYPLPEHMKPLNS

Gene
ectC
Protein
L-ectoine synthase
Organism
Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Length
133 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.785 kDa
Sequence
MIVRNVKDVIGTQDEVRTDTWVSRRVLLKKDGMGFSFHETTIFPGGRTHIHYKNHLEAVWCIEGDGSIETIADGKKYELGPGVVYALNEHDEHWLCGGKEPLRVICVFNPPLTGQEVHDADGVYALPAEAQAA

Gene
ectC
Protein
L-ectoine synthase
Organism
Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)
Length
133 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.017 kDa
Sequence
MIVRDYNKAKETDRRVVASQWESVRLLLKSDNMGFSFHITTIYEGAELPMEYKHHLESVYCLSGEGEVETLADGKIHPIRPGVIYILDHNDQHILRAKTEMQMACVFNPPLTGKEVHDSSGAYPLEAEAVTAD

Gene
ectC
Protein
L-ectoine synthase
Organism
Rhodococcus jostii (strain RHA1)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.883 kDa
Sequence
MIVRTTAEITDTDRDITSEDGNWRSKRIILGGDKVGFSFHETTIKAGSVNEFHYANHVEAVWLVEGTGKLIDLDNDKVYELGPGSMYLLNGHERHRVEPETEMRMLCVFNPPVTGREVHDENGVYPLVEVPA

Gene
ectC
Protein
L-ectoine synthase
Organism
Rhodococcus opacus (strain B4)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.911 kDa
Sequence
MIVRTTAEITDTERDITSEDGNWRSKRIILGGDKVGFSFHETTIKAGSVNEFHYANHVEAVWLVEGTGKLIDLDNDKVYELGPGSMYLLNGHERHRVEPETEMRMLCVFNPPVTGREVHDENGVYPLIEVPA

Gene
ectC
Protein
L-ectoine synthase
Organism
Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.892 kDa
Sequence
MIVRTLAEAEASDRRVTSENWESVRLLLKDDNMGFSFHITTIFEGADFEMHYKNHLESVFCMSGEGEVETLADGKVYPIKPGTIYILDKHDKHVLRATKEMKMACVFNPPVTGKEVHDESGAYPLEAEAIVD

Gene
ectC
Protein
L-ectoine synthase
Organism
Streptomyces anulatus
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.971 kDa
Sequence
MIVRSFSDIENTDRHVKAASGTWESKRIVLAKEKVGFSLHETVLYAGTETSMWYANHIEAVLCTEGEAELTNDETGETHWITPGTMYLLDGHERHTMRPKTDFRCVCVFNPPVTGREDHDENGVYPLLTEEA

Gene
ectC
Protein
L-ectoine synthase
Organism
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.988 kDa
Sequence
MIVRSFKEFEGTDRHVKSASGTWESTRIVLAKEKVGFSVHETILYAGTETSMWYANHIEAVVCTKGDAELTDRETGKTYHITPGTMYLLDGHERHTLKVKEDFHCICVFNPPVTGREDHDENGVYPLLTEEV

Gene
ectC
Protein
L-ectoine synthase
Organism
Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.987 kDa
Sequence
MIVRSFSDIENTDRHVKSASGTWESKRIVLAKEKVGFSLHETVLYAGTETSMWYANHIEAVLCTEGEAELTNDETGETHWITPGTMYLLDGHERHTMRPKTDFRCVCVFNPPVTGREDHDENGVYPLLTEEA

Gene
ectC
Protein
L-ectoine synthase
Organism
Teredinibacter turnerae (strain ATCC 39867 / T7901)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.21 kDa
Sequence
MIVRNLTEARDSNRRIVSPDGNWESTRMLLKDDKMGFSFHITTIYKGADFRMHYQNHLESVYCVRGRGEVETLADGKKYPIEPGTLYILDKHDEHMLRAFEEMEMACVFNPPLNGTEVHNAEGAYELNAEAL

Gene
ectC
Protein
L-ectoine synthase
Organism
Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.191 kDa
Sequence
MKIVKLQDIIGTEREVHGEGWRSRRILLKKDKMGFSLHETIWPPGHELRMWYKNHLEAVYCVAGNGSIEDLETGEVHELYDGVCYALDKHDRHILRGGTEEMRLVCVFNPPVTGLEVHDEDGAYCLVEDDDD

Gene
ectC
Protein
L-ectoine synthase
Organism
Bordetella avium (strain 197N)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.842 kDa
Sequence
MIVRNVKDVIGTPDEVRTDTWVSRRVLLKKDKMGFSFHETTIFPGTRTHIHYKNHLEAVWCIEGDGSIETIADGKRYDLGPGVVYALNEHDEHWLCGGKEPLRVICVFNPPLTGQEVHDADGVYALPQAETA

Gene
ectC
Protein
L-ectoine synthase
Organism
Hahella chejuensis (strain KCTC 2396)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
15.077 kDa
Sequence
MIVRTLEQARQSDRRVKADNWESVRMLLKDDNMGFSFHITTLYANKETPIHYQNHLESVYCISGEGEVETVADGEVHAIKPGTLYVLDKHDKHLLRAFSEMTVACVFNPPLNGKETHDENGVYPLEAETIME

Gene
ectC
Protein
L-ectoine synthase
Organism
Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Length
132 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.941 kDa
Sequence
MIVRTTTEITDTDRDITSEDGNWRSKRIVLGGDRVGFSFHETTIKAGSVNEFHYANHVEAVWLVEGTGKLIDLDNNKEYDLAPGSMYLLNGHERHRVEPDTQMRMLCVFNPPVTGREVHDENGVYPLVEVPA

Gene
ectC
Protein
L-ectoine synthase
Organism
Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W)
Length
131 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.892 kDa
Sequence
MIVKTKEEVVGTPREIFAPNGHWISRRYLLAGEGMGFSFHETIILAGTKTHIHYQNHLEAVFCVQGRGEVELIPSGERFLIEEGVMYALDKHDEHYLSASEEMRLICVFNPPLQGNEVHDEKGVYPLKKGQ

Gene
ectC
Protein
L-ectoine synthase
Organism
Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Length
131 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.672 kDa
Sequence
MIVRNVKDVMGTEDEVRTDTWVSRRVLLKKDGMGFSFHETTIFPGTRTHIHYKNHLEAVWCIEGDGSIETIADGKTYELGPGVVYALNENDEHWLCGGKQPLRVICVFNPPLTGQEVHDAEGVYALVEEAA

Gene
ectC
Protein
L-ectoine synthase
Organism
Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Length
131 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.672 kDa
Sequence
MIVRNVKDVMGTEDEVRTDTWVSRRVLLKKDGMGFSFHETTIFPGTRTHIHYKNHLEAVWCIEGDGSIETIADGKTYELGPGVVYALNENDEHWLCGGKQPLRVICVFNPPLTGQEVHDAEGVYALVEEAA

Gene
ectC
Protein
L-ectoine synthase
Organism
Nocardia farcinica (strain IFM 10152)
Length
131 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.604 kDa
Sequence
MIVRTTDEITGTERDVAGPGWRSKRIVLGGDGVGFSFHETTIDAGTTHEFHYVHHIEAVWLVEGEGTLTDLDNDQVYDLRPGTMYLLNGHEKHRVQARTTMRMMCVFNPPVTGQEVHDENGVYPLVAVPAS

Gene
ectC
Protein
L-ectoine synthase
Organism
Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)
Length
130 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.825 kDa
Sequence
MIVRNLEECRKTERFVEAENGNWDSTRLVLADDNVGFSFNITRIHPGTETHIHYKHHFEAVFCYEGEGEVETLADGKIHPIKAGDMYLLDQHDEHLLRGKEKGMTVACVFNPALTGREVHREDGSYAPVD

Gene
ectC
Protein
L-ectoine synthase
Organism
Desulfatibacillum aliphaticivorans
Length
130 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.667 kDa
Sequence
MLVRQLDDILGTDADVKGETGTWASRRLLLKKDGMGFSLHDTIIYPGTETHLWYKNHLEAVYCIHGKGEIELVPSGELIPIRPGTMYALDKHDEHLLRASEELRLVCVFNPPLTGREDHDEDGAYPVLDD

Gene
ectC
Protein
L-ectoine synthase
Organism
Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543)
Length
130 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.185 kDa
Sequence
MIVRTTQQITGTERDVSGDGWHSKRIVLADDGVGFSFHETTIDAGTVHVFHYQHHIEAVWLTAGTGTLTNLENGDVFTLGPGSMYLLDGNERHQLSADSEMRMMCVFNPPVTGREVHDESGAYPAAPALS

Gene
ectC
Protein
L-ectoine synthase
Organism
Mycobacterium gilvum (strain PYR-GCK)
Length
130 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.566 kDa
Sequence
MIVRTTDEITGTHRDVAAANWRSKRIVLADDAVGFSFHETTIDADSVSEFHYRHHVEAVWIVEGTGTLTNHETGEEHPLRPGTMYLLNGHERHRVTCDTTMRMLCVFNPPVTGQEIHDETGAYPPAVQAS

Gene
ectC
Protein
L-ectoine synthase
Organism
Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)
Length
130 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.566 kDa
Sequence
MIVRTTDEITGTNRDVAAEHWRSKRIILADDGVGFSFHETTIDANSVSEFHYQHHVEAVWVVEGTGTLTNHETGEVHPLRPGTMYLLNGHERHRVTCDTTMRMLCVFNPPVTGREIHDENGAYPAAVQAS

Gene
ectC
Protein
L-ectoine synthase
Organism
Phenylobacterium zucineum (strain HLK1)
Length
130 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.629 kDa
Sequence
MIVRDLSQAEKTDRRVVSKGWESTRLLLKDDAMGFSFHITTIYEGAELPMHYKNHLEAVYCISGEGSIEDLATGQVHEIRPGVLYALDKHDRHVLRGRTQMVMACAFNPPVTGREVHDETGAYPLEAEMA

Gene
ectC
Protein
L-ectoine synthase
Organism
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Length
129 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.783 kDa
Sequence
MKVVKLEDVIGTEQEVKGENWTSRRLLLKKDGMGYSVHDTIIKAGTETHIWYQNHLEAVYCIEGEGEVETVKDGKVWPIKANEIYALDEHDEHLLRAKTDMRMVCVFNPPITGKETHDENGVYPLVDDE

Gene
ectC
Protein
L-ectoine synthase
Organism
Desulfococcus oleovorans (strain DSM 6200 / Hxd3)
Length
129 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.526 kDa
Sequence
MIVRDLQEILGTDREVTGEGWTSRRLLLKKDGMGFSFHETIIAAGTEHLFWYKNHLEAVYCVAGNGTIEDLATGQVHRIKNGVLYALNNHDRHVLRGGTEDMRLICAFNPPVTGRETHDSDGSYELVEE

Gene
ectC
Protein
L-ectoine synthase
Organism
Marinococcus halophilus
Length
129 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.797 kDa
Sequence
MKVIKLEDLLGTEREVDDGNWVSRRFIMKDDNMGYSVNDTIIRAGTETHIWYQNHLETVYCIEGDGEIETLSDNKVYQLEPGVLYALDKNDEHMLRGGSKDMRMVCVFNPPLSGREVHDENGVYPADLD

Gene
ectC
Protein
L-ectoine synthase
Organism
Marinomonas sp. (strain MWYL1)
Length
129 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.841 kDa
Sequence
MFARDLAECEKTERRVVSPDGNWESTRLLLKEDNMGFSFHITTIYEGKDFDMHYQNHLESVYCISGEGEVESRETGQKHHIKPGVVYVLDKHDAHTLRAFKELKLACVFNPPITGKEVHNSEGAYEILE

Gene
ectC
Protein
L-ectoine synthase
Organism
Mycobacterium sp. (strain KMS)
Length
129 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.399 kDa
Sequence
MIVRTTQAITGTERDVAAKDWRSKRIVLADDGVGFSFHETTINANSVSEFHYRHHVEAVWVVEGSGTLTDHETGEEFPLLPGTMYLLDGHERHRVTCHEQLRMLCVFNPPVTGQEVHDESGAYPAPVAS

Gene
ectC
Protein
L-ectoine synthase
Organism
Mycobacterium sp. (strain MCS)
Length
129 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.399 kDa
Sequence
MIVRTTQAITGTERDVAAKDWRSKRIVLADDGVGFSFHETTINANSVSEFHYRHHVEAVWVVEGSGTLTDHETGEEFPLLPGTMYLLDGHERHRVTCHEQLRMLCVFNPPVTGQEVHDESGAYPAPVAS

Gene
ectC
Protein
L-ectoine synthase
Organism
Vibrio campbellii (strain ATCC BAA-1116 / BB120)
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.746 kDa
Sequence
MIVRTLDECRNSERRVVSDNWESVRMLLKDDNMGFSFHITTIYEGTETHIHYQNHLESVFCMSGEGEIEVVGGETYPIKPGTLYILDKNDEHYLRAYKNKEMVMACVFNPPITGAEVHDENGVYPLVD

Gene
ectC
Protein
L-ectoine synthase
Organism
Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.753 kDa
Sequence
MIVRTLDECRNSERRVVADNWESVRMLLKDDNMGFSFHITTIYEGTETHIHYQNHLESVFCMSGEGEIEVVGGETYPIKPGTLYILDKHDEHYLRAYKNKEMVMACVFNPPITGAEVHDENGVYPLVD

Gene
ectC
Protein
L-ectoine synthase
Organism
Vibrio tasmaniensis (strain LGP32)
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.864 kDa
Sequence
MIVRTLDECRNSERRIVSDNWESTRMLLKDDNMGFSFHITTIYEATETHIHYQNHLESVYCMSGEGEIEVVGGETYPIKPGTLYILDKHDEHYLRAYKYKEMVMACVFNPPITGAEVHDENGVYPLVD

Gene
ectC
Protein
L-ectoine synthase
Organism
Virgibacillus pantothenticus
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.775 kDa
Sequence
MIVKSLDDIIGTDDETSSDNWTSRRFIMKKDNVGFSLNDTLIKAGTTNFFWYKNHIEAVYCIEGEGEIEKLETGEIYKLKAGTMYLLNEHDKHELRAKTQMRMVCVFNPPLVGTETHTEEGYYPLLTE

Gene
ectC
Protein
L-ectoine synthase
Organism
Aliivibrio fischeri (strain ATCC 700601 / ES114)
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.816 kDa
Sequence
MIVRTLDECRDSERRVASETWESVRMLLKNDNMGFSFHITTIYQDTETHIHYKNHLESVYCMSGEGEIEVVGGETYPIKPGTLYILDKHDEHYLRAYKDKEMVMACVFNPPITGAEVHDENGVYPVLD

Gene
ectC
Protein
L-ectoine synthase
Organism
Aliivibrio fischeri (strain MJ11)
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.86 kDa
Sequence
MIVRTLDECRDSERRVASETWESVRMLLKNDNMGFSFHITTIYQDTETHIHYKNHLESVYCMSGEGEIEVIGGETYPIKPGTLYILDKHDEHYLRAYKDKEMVMACVFNPPITGTEVHDENGVYPVLD

Gene
ectC
Protein
L-ectoine synthase
Organism
Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.396 kDa
Sequence
MIVRSLHDIEATDHFVDWGNSTSHRLLTDKDGMGFSICHTIVRANTVSLLQYRNHLEACFCIGGEGEVEDMDGNVFPIRRGDMYVLDKHDKHLLRGGPDKDMILVSIFNPPLTGTERHKLDDPAGSTY

Gene
ectC
Protein
L-ectoine synthase
Organism
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Length
128 amino acids
Function
Catalyzes the circularization of gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4-pyrimidine carboxylic acid), which is an excellent osmoprotectant.
Similarity
Belongs to the ectoine synthase family.
Mass
14.763 kDa
Sequence
MIVKSLEDIQGTEDHQKGETWESRRFVLNKDNVGFSLNDTIIKAGTESYFWYKNHIEAVYCIEGEGEVEKKDTGEVWQLKPGTMYLLNDNDKHYLRAKTQMRMVCVFNPALVGTETHDEDGVYPLLAE