eIF3-S5

Eukaryotic translation initiation factor 3 subunit F

289 amino acids

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.

Belongs to the eIF-3 subunit F family.

30.993 kDa

MALNISVKVHPVVLFQIVDAYERRNADSHRVIGTLWGTSDKGVVEVTNCFCVPHKEHADQVEAELNYAMDVYELNRRVNSSESIVGWWATGNEVTNHSSVIHEYYSRECREPVHVTLDTSLAGGRMGLRAYVCVPLGVPNGKQGCMFTPVDVTLTCYEPEIVGLQVCQKTVSGGGRGSSGVAAGSDLAQVMSAASSLESLLEQALQYADGAAAGAPADAEAGRALLQLAHSAPDLAKDTFSDAFASSVKDLLMVVTLAQLIKTQLQLNEKLTLLTSPVNTTIYKGRPNV

eIF3-S5

Eukaryotic translation initiation factor 3 subunit F

287 amino acids

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.

Belongs to the eIF-3 subunit F family.

31.659 kDa

MSTINLPLNLTVRVHPVVLFQIVDAYERRNADSERVIGTLLGSVDKGVVEVTNCFCVPHKEHADQVEAELGYASDLYDLNRRVNPSENIVGWWATGQEVTNHSSVIHEYYARECNNPIHLTLDTSLSAARMGIKAYVCVSLGVPGGKTGCMFTPINVEISSYEPEVVGLQLCSKTIGVQQNASRPRTVSPMLDLAQITEASDKLLTLLGEVLNYVEDVLAEKQQPDNSVGRALLDLIHSVPNMTSDQFAQMFNSNVKDLLMVVTLSQLIKTQLQLNEKLTSLTSFIN

eIF3-S5

Eukaryotic translation initiation factor 3 subunit F

287 amino acids

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.

Belongs to the eIF-3 subunit F family.

31.594 kDa

MSTINLPLNLTVRVHPVVLFQIVDAYERRNADSERVIGTLLGSVDKGVVEVTNCFCLPHKEHTDQVEAELGYASDLYELNQRVNASENIVGWWATGQEVTNHSSVIHEYYARECTNPVHLTLDTSLTGARMGIKAYVCVSLGVPGGKSGCMFTPINVEVTSYEPEIVGLQLCMKTIGVQSNPSRPRTVSPMLDLAQVTDASDKLLALLSDVLAYVEDVLSEKQQPENTVGRALLDLIHSVPNMTGDQFAQMFNSNVKDLLMVVTLSQLIKTQLQLNEKLTSLTSFLN

eIF3-S5

Eukaryotic translation initiation factor 3 subunit F

287 amino acids

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation.

Belongs to the eIF-3 subunit F family.

31.667 kDa

MSTINLPLNLTVRVHPVVLFQIVDAYERRNADSERVIGTLLGSVEKGIVEVTNCFCVPHKEHADQVEAELGYASDLYDLNRRVNPSENIVGWWATGQEVTNHSSVIHEYYARECNNPIHLTLDTSLTAARMGIKAYVCVSLGVPGGKTGCMFTPINVEVTSYEPEVVGLSLCAKTIGVQSNPARPRTVSPMLDLAQVSEASGKLQTLLGEVLNYVEDVLAEKQQPDNFVGRALLDLIHSVPNMKHEEFAKMFNSNVKDLLMVVTLSQLIKTQLQLNEKLTSLTSFLS