Eif1a

Eukaryotic translation initiation factor 1A

144 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

16.502 kDa

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

EIF1A

Eukaryotic translation initiation factor 1A

144 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

16.528 kDa

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMLFDGVKRLFHIRGKLRKKVWINTSDIILVGLREYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

Eif1a

Eukaryotic translation initiation factor 1A

144 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

16.502 kDa

MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVRRLCHIRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI

eif1a

Eukaryotic translation initiation factor 1A

141 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

16.448 kDa

MPKNKGKGGKNRRRGKNENEQKRELQFKEEGQEYAQVLRMLGNGRLEASCFDGEKRLCHISGRLRKKEWINNGDIILIQLRDYQNDKADVILRYNVDEARNLKTYGELPETARINETDAFDDVEDIPFEFVAEDDIDIDTL

eIF1A

Translation initiation factor 1A

123 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

14.531 kDa

MSPDKTEDEDKDVNVDQDQFNEEEESLGRVILPNKKKGEMFGIVEKMEGASRLSVMCEDGYTRNARIPGRMRKRMWIREKDLVIVKPWEFQPEKADVVYRYTKTQASYLSRNHMLPEVIDIFK

eIF1A

Translation initiation factor 1A

119 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

13.949 kDa

MSEDDVDNSVKDFESGEENEESIGRVILPNKKKGEMFGIVEKMEGASRLSVMCEDGYTRNARIPGRMRKRMWIREKDLVIVKPWEFQPEKADVVYRYTKTQASYLSRNHMLPEVIDIFK

eif1a

Translation initiation factor 1A

117 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

13.539 kDa

MAGKKKNDRHVEGDEVIRVPLPDRSKGQLFGVIEQALGAGWMDVRCEDGKVRRCRIPGKLKRRMWMRVGDVVIVQPWPVQSDERGDIVYRYTRTQVDWLLRKGKITQDFLSGGELLF

eIF1A

Translation initiation factor 1A

116 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.997 kDa

MRCLSKKHQKQGDEHGGEIPLPNPDEGTIICGVVRHLGGDYLIAKCLDGVDRKIRIPGKLRRKVWITEGDIILVGLWDFSSEKGEVVYKYGKNEVNKLVEKGVVPKEFIDALSELI

eIF1A

Translation initiation factor 1A

115 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

13.317 kDa

MLMPKKERKVEGEEVIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGKVRRCRIPGRLRRRVWIKVGDLVIVEPWPVQSDKRGDIVYRYTQTQVEWLLRKGKISQEFLTGGSLLLE

eIF1A

Translation initiation factor 1A

115 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

13.316 kDa

MIMPKKERKVEGEEVIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVWIRVGDLVIVQPWPVQSDKRGDIVYRYTQTQVDWLLRKGKITQEFLTGGSLLVE

eIF1A

Translation initiation factor 1A

114 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

13.225 kDa

MARLRIINFYRSAYCSAMSEFRLPGEGEILGKVIEMLGDGRFKVICADGQIRVARLPGRLRRRLWLKAGDYVIVALWDFDREKGDIVHKYEKRDVEELKRRGFAEAIEALDSYA

eIF1A

Translation initiation factor 1A

113 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

13.057 kDa

MPKKERKVEGDEVIRVPLPEGNQLFGVVEQALGAGWMDVRCEDGKIRRCRIPGKLRRRVWIRVGDLVIVQPWPVQSDKRGDIVYRYTQTQVDWLLRKGKITQEFLTGGSLLVE

eIF1A

Translation initiation factor 1A

111 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

13.083 kDa

MGKRIDDETLKKIRLPKEGEIFGVVEKMLGNDRVQVRCVDGKTRVARIPGKMRKRVWIREGDVVLVKPWEFQPERADVTWRYTRVQVDWLKRKGKLDERVTKLLEEIIPGA

eif1a

Translation initiation factor 1A

111 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

13.133 kDa

MKKSNNKNNHKNNHNNNQGGENIRVRSPRRGEIPGVVEQILGHGKLKVRCNDKQIRLCRIPGKMKKRIWIREGDVVLVKPWDFQSDEKADVIWRYTRTEANYLERRGFLKI

eIF1A

Translation initiation factor 1A

111 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

12.736 kDa

MARGRGRHERRGEMPLPSEDEGTMLCIVQRVVGAGFLEVLCTDGEVYMARIPGKMRRRVWMREGDVVLFLPWGTADKKGEVVYRYLRDEVRKLIDMNLLPEELVEEVAGAE

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.417 kDa

MPKKDRTDQAPSKDVPKPEEGEVICVVKKMLGAEHIIIACLDGKERTARIPGRMRKKTWIKEGDVVLAAPWDFQPTKADIVYRYMNDEIRKLIEEKVISRDVIDQLRG

eif1a

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.625 kDa

MDNDNDENTIRVITPNKKSGEIYGIVEKMSGASRLIVMCEDGVTRNCRIPGKMKKRMWIREGDLVIVKPWEFQDEKGDIIYRYTKTQAAYLSRNHMLPEIIDVFNEKQ

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

12.518 kDa

MPKKDRAQEAPSRDVPRPEEGQTICVVKKMLGGDHLIVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG

eif1a

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.376 kDa

MAKKKSNTEQPTREVVKPIEGEVICVVKKLFGGEHVQVICTDGKERLGRIPGKLKKKVWIREGDVVLAAPWDFQPNKCDIVYRYTESEVRRLVEDKVISQDVIEQLRG

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.476 kDa

MPKKDRAQEAPSRDVPKPEEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.476 kDa

MPKKDRAQEAPSRDVPKPEEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.476 kDa

MPKKDRAQEAPSRDVPKPEEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.476 kDa

MPKKDRAQEAPSRDVPKPEEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.476 kDa

MPKKDRAQEAPSRDVPKPEEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.476 kDa

MPKKDRAQEAPSRDVPKPEEGQTICVVKKMLGGDHLVVLCMDGKERLARIPGKIRKKMWMREGDVVLVGIWDFQPNRCDILYKYGNDEIKRLVNENIISREVIDQLRG

eIF1A

Translation initiation factor 1A

108 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

12.279 kDa

MAKKKTNEQPSVKEVPKPAEGEVICVVKKMLGAEHVQVICLDGKERLGRIPGKMKKKMWVKEGDVVLAAPWDFQPNKCDIIYKYSESEVRRLEEEQVVSADIIEQLRG

eif1a

Translation initiation factor 1A

106 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.154 kDa

MKKNNGGRGSKTDAPAVTRVRTPRRENNEILATVSALLGGKRVTLQCMDGIVRMGRIPGSKKKRMWVREGDIVIITPWDFQDSKAEVIWKYTRPQVEWLERKGFLK

eIF1A

Translation initiation factor 1A

105 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.336 kDa

MQKKPMAPQQPTRVRTPREENNEILGIIEQMLGASRVRVRCMDGHTRMGRIPGKLKRKIWVREGDIVIVVPWEVQSDQKCDIIWRYTKGQVSWLSKKGYLKQAYD

eIF1A

Translation initiation factor 1A

105 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.381 kDa

MGRIENDNQDVSDDGSIIRVKLPNKRIREQFAQAELMLGSNHIRVRCSDGVTRLGRIKGKIKKRVWIREGDILIVVPWDFQDDKCDIIYRYTTPQVDWLRAHKYL

eIF1A

Translation initiation factor 1A

104 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.297 kDa

MRGQQAPPQQPTRVRTPRENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIWVREDDVVIVTPWEVQSDEKCDVIWRYTKGQVDWLNKKGYLDFMR

eIF1A

Translation initiation factor 1A

104 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.297 kDa

MRGQQAPPQQPTRVRTPRENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIWVREDDVVIVTPWEVQSDEKCDVIWRYTKGQVDWLNKKGYLDFMR

eif1a

Translation initiation factor 1A

104 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.355 kDa

MRGQQTPPQQPTRVRTPRENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIWVREDDVVIVTPWEVQSDEKCDVIWRYTKGQVDWLNRKGYLDFMR

eIF1A

Translation initiation factor 1A

103 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

12.242 kDa

MRGQQAPQQPTRVRTPRENENEVLGVIEQMLGASRVRVRCMDGKLRMGRIPGKLKRKIWVREDDVVIVTPWEVQSDEKCDVIWRYTKGQVDWLNRKGYLEFMR

eIF1A

Translation initiation factor 1A

102 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

12.184 kDa

MAEQQQEQQIRVRIPRKEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIWVREGDVVIVKPWEVQGDQKCDIIWRYTKTQVEWLKRKGYLDELL

eIF1A

Translation initiation factor 1A

99 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

11.749 kDa

MSRGHQTQEVRRVRTPRRGEIPGVVEQIMGHGKLKVRCADGHIRLGRIPGKMKKRIWIREGDVVLVKPWEFQSEEKADIVWRYTRTESNWLERKGYLKL

eif1a

Translation initiation factor 1A

97 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

11.432 kDa

MSDNEGRKNLRMPEGDEVFAVVTNMLGANRVKVRCMDGTERTARIPGRMQKRIWIREDDVVLVEPWDWQDEKADVVWRYEKQEADQLREEGHITDSV

eIF1A

Translation initiation factor 1A

97 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits (By similarity).

Belongs to the eIF-1A family.

11.385 kDa

MSSEDDVIRVRLPDRKKGELFGVVTSMLGAGHIKVRCEDGVERLARIPGKMRKKIWIREGDVVIVVPWSFQKDRADIVWRYTNPQVEWLERKGYLKF

eif1a

Translation initiation factor 1A

95 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

11.378 kDa

MSDNDSRKNLRMPEEDEVFAVVMDMLGANRVKVRCMDGVERTARIPGKMQKRIWIREDDVVLVEPWDWQDEKADITWRYEKQDADQLREEGHIQE

eIF1A

Translation initiation factor 1A

95 amino acids

Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.

Belongs to the eIF-1A family.

11.148 kDa

MSDDGGGRKNLRMPEDDEVFAEVTDMLGANRVQVRCADGEERTARIPGRMQKRIWIREDDIVLVEPWDWQDDKADVTWRYEKSDADQLREEGHIE