drrB

Doxorubicin resistance ABC transporter permease protein DrrB

289 amino acids

Part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane (By similarity).

Belongs to the ABC-2 integral membrane protein family.

31.109 kDa

MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIGAVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP

drrB

Doxorubicin resistance ABC transporter permease protein DrrB

289 amino acids

Part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the ABC-2 integral membrane protein family.

31.109 kDa

MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIGAVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP

drrB

Daunorubicin/doxorubicin resistance ABC transporter permease protein DrrB

283 amino acids

Part of the ABC transporter complex DrrAB involved in daunorubicin and doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane.

Belongs to the ABC-2 integral membrane protein family.

30.614 kDa

MTTSPGTVESTTPVSGQLRTVLSAGERPARATAVSATLTHLWRAMMAFKHFPVQLIDIVLMPLIFLLMFTYLFGGAFADSTEEYLQFYLPGVTVQAVVMMTVYTGTSLNTDIHKGVFDRFRTLPFWQPATLAGSLLGDVLRYVVALATTVSLGLLLGFRADGGFLGVVGAMLVLIVFGFSVSWIFAALGVVASEPERVSGTSMIVLYPLLFMSNIFVMPETMPGWMQAIVDANPMSHAATASRELMHGTAGFWDVGLVLCVSAGLVAVFAPLTMRLYRNKNAH