dpgA

3,5-dihydroxyphenylacetyl-CoA synthase

372 amino acids

Involved in the biosynthesis of the nonproteinogenic amino acid monomer (S)-3,5-dihydroxyphenylglycine (Dpg) responsible of the production of balhimycin antibiotic (PubMed:11495926). Catalyzes the Claisen condensation of four molecules of malonyl-CoA to yield 3,5-dihydroxyphenylacetyl-CoA (DPA-CoA) and three free coenzyme A (CoA). DpgA requires the presence of the dehydratases DpgB and DpgD to facilitate the aromatization of the DPA-S-DgpA or DPA-S-CoA intermediate.

Belongs to the thiolase-like superfamily. Chalcone/stilbene synthases family.

39.491 kDa

MGVDVSMTTSIEPAEDLSVLSGLTEITRFAGVGTAVSASSYSQSEVLDILDVEDPKIRSVFLNSAIDRRFLTLPPESPGGGRVSEPQGDLLDKHKELAVDMGCRALEACLKSAGATLSDLRHLCCVTSTGFLTPGLSALIIRELGIDPHCSRSDIVGMGCNAGLNALNVVAGWSAAHPGELGVVLCSEACSAAYALDGTMRTAVVNSLFGDGSAALAVISGDGRVPGPRVLKFASYIITDALDAMRYDWDRDQDRFSFFLDPQIPYVVGAHAEIVADRLLSGTGLRRSDIGHWLVHSGGKKVIDSVVVNLGLSRHDVRHTTGVLRDYGNLSSGSFLFSYERLAEEGVTRPGDYGVLMTMGPGSTIEMALIQW

dpgA

3,5-dihydroxyphenylacetyl-CoA synthase

370 amino acids

Involved in the biosynthesis of the nonproteinogenic amino acid monomer (S)-3,5-dihydroxyphenylglycine (Dpg) responsible of the production of vancomycin and teicoplanin antibiotics. Catalyzes the Claisen condensation of four molecules of malonyl-CoA to yield 3,5-dihydroxyphenylacetyl-CoA (DPA-CoA) and three free coenzyme A (CoA). DpgA requires the presence of the dehydratases DpgB and DpgD to facilitate the aromatization of the DPA-S-DgpA or DPA-S-CoA intermediate.

Belongs to the thiolase-like superfamily. Chalcone/stilbene synthases family.

39.582 kDa

MDVSMTTGIELTEELSVLNGLTEITRFAGVGTAVSETSYSQTELLDILDVEDPKIRSVFLNSAIDRRFLTLPPENPGGGRLAEPQGDLLDKHKKIAVDMGCRALEACLKSAGATLSDLRHLCCVTSTGFLTPGLSALIIREMGIDPHCSRSDIVGMGCNAGLNALNVVSGWSAAHPGELGVVLCSEACSAAYALDGTMRTAVVNSLFGDGSAALAVISGDGRVAGPRVLKFASYIITDAVDAMRYDWDRDQDRFSFFLDPQIPYVVGAHAEIVVDRLLSGTGLRRSDIGHWLVHSGGKKVVDAVVVNLGLSRHDVRHTTGVLRDYGNLSSGSFLFSYERLSEEDVTRPGDYGVLMTMGPGSTIEMALIQW