dltC1

D-alanyl carrier protein 1

80 amino acids

Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall.

Belongs to the DltC family.

8.798 kDa

MTMDDTKATVLSILADLTGEDVSSNMDVNLFDEGILDSMGSVQLLLELQNQLGIEVPVSEFQRSEWDTPAKIVAKVENLQ