desA

Sphingolipid 10-desaturase

515 amino acids

Fatty acid desaturase that catalyzes the introduction of the third double bond at the Delta(10) position in d18:3Delta4,8,10 triunsaturated sphingolipid long fatty acid chains. The cytochrome b5 domain probably acts as the direct electron donor to the active site of the desaturase.

Belongs to the fatty acid desaturase type 1 family.

58.957 kDa

MRAVWALLWALQLGTLVGCALVLGVHHFSGDNLTKQSAIPTKSSKAKPISDQKAAVTSGSTCAVREKARKDGLVLLDGNWYNVEKFVHHHPGGVEVLEQYLGADISFVFRVMHRNPTQIMKYRKPVRAATPEELEALTSRRQEVCLDMMDDFVTNSIDIASPEMLPKPTQFDLKSFEKDFIDLYEEFVAQGYFKPSTTWLLWNTAVLISIIALSVISMKVLPPTSFVLPGALLGLFWHQSGFLMHDAEHHNLAGNERLNDILGWIYGTVFLGVNGAWWREEHREHHAFLNTYDDESGFKDPQMREDVWIQNKKLIPFFGDEIIHFLTNFQHILFLPIIFIVGRVGIVVDSTLTERKFRPWTILGNVCHILLHYAILSQTSRPIPVYIIGSLWQAILSLQLLGNHYVKPWNRLNDATEGNFCVWQILSTQDFACPRWSRWLYGGLNFHYSHHLFPTLSREYFHITSPRIRTLCEKHGLPFIEIAFIDCVVGMVNNFNEVRKDFATKGHGSVAFMYT

desA

Syringate O-demethylase

462 amino acids

Involved in the catabolism of syringate. Catalyzes the conversion of syringate to 3-O-methylgallate (3MGA) in the presence of tetrahydrofolate. Has weak activity with vanillate and 3-O-methylgallate.

Belongs to the GcvT family.

50.778 kDa

MAKSLQDVLDNAGNAVDFLRNQQTGPNVYPGVPAEYSNWRNEQRAWAKTAVLFNQSYHMVELMVEGPDAFAFLNYLGINSFKNFAPGKAKQWVPVTAEGYVIGDVILFYLAENQFNLVGRAPAIEWAEFHAATGKWNVTLTRDERTALRTDGVRRHYRFQLQGPNAMAILTDAMGQTPPDLKFFNMADIQIAGKTVGALRHGMAGQPGYELYGPWADYEAVHSALVAAGKNHGLALVGGRAYSSNTLESGWVPSPFPGYLFGEGSADFRKWAGENSYGAKCSIGGSYVPESLEGYGLTPWDIGYGIIVKFDHDFIGKEALEKMANEPHLEKVTLALDDEDMLRVMSSYFSDSGRAKYFEFPSAVYSMHPYDSVLVDGKHVGVSTWVGYSSNEGKMLTLAMIDPKYAKPGTEVSLLWGEPNGGTSKPTVEPHEQTEIKAVVAPVPYSAVARTGYADSWRTKKA

desA

Delta(12)-fatty-acid desaturase

351 amino acids

Can introduce a second cis double bond at the Delta(12) position of fatty acid bound to membranes glycerolipids. This enzyme is involved in chilling tolerance because the phase transition temperature of lipids of cellular membranes depends on the degree of unsaturation of fatty acids of the membrane lipids.

Belongs to the fatty acid desaturase type 1 family.

40.928 kDa

MTLSIVKSEDSSSRPSAVPSDLPLEEDIINTLPSGVFVQDRYKAWMTVIINVVMVGLGWLGIAIAPWFLLPVVWVFTGTALTGFFVIGHDCGHRSFSRNVWVNDWVGHILFLPIIYPFHSWRIGHNQHHKYTNRMELDNAWQPWRKEEYQNAGKFMQVTYDLFRGRAWWIGSILHWASIHFDWTKFEGKQRQQVKFSSLLVIGAAAIAFPTMILTIGVWGFVKFWVIPWLVFHFWMSTFTLLHHTIADIPFREPEQWHEAESQLSGTVHCNYSRWGEFLCHDINVHIPHHVTTAIPWYNLRTPTPVYRKIGGEYLYPECDFSWGLMKQVVDHAICMMRITIISQSLTTKRV

desA

Delta(12)-fatty-acid desaturase

351 amino acids

Can introduce a second cis double bond at the Delta(12) position of fatty acid bound to membranes glycerolipids. This enzyme is involved in chilling tolerance because the phase transition temperature of lipids of cellular membranes depends on the degree of unsaturation of fatty acids of the membrane lipids.

Belongs to the fatty acid desaturase type 1 family.

40.495 kDa

MTATIPPLTPTVTPSNPDRPIADLKLQDIIKTLPKECFEKKASKAWASVLITLGAIAVGYLGIIYLPWYCLPITWIWTGTALTGAFVVGHDCGHRSFAKKRWVNDLVGHIAFAPLIYPFHSWRLLHDHHHLHTNKIEVDNAWDPWSVEAFQASPAIVRLFYRAIRGPFWWTGSIFHWSLMHFKLSNFAQRDRNKVKLSIAVVFLFAAIAFPALIITTGVWGFVKFWLMPWLVYHFWMSTFTIVHHTIPEIRFRPAADWSAAEAQLNGTVHCDYPRWVEVLCHDINVHIPHHLSVAIPSYNLRLAHGSLKENWGPFLYERTFNWQLMQQISGQCHLYDPEHGYRTFGSLKKV