ddp-1

Mitochondrial import inner membrane translocase subunit Tim8

83 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The ddp-1/tim-8-tim-13 complex mediates the import of some proteins while the predominant tim-9/tin-9.1-tim-10/tin-10 70 kDa complex mediates the import of much more proteins.

Belongs to the small Tim family.

9.482 kDa

MDSADPQLARFLHQLQAETQRQKFTEQVHTLTGRCWDVCFSDYRPPSKMDGKTQTCIQNCVNRMIDASNFMVEHLSKMNGGSA

ddp-1

Mitochondrial import inner membrane translocase subunit Tim8

83 amino acids

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane (By similarity). Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane (By similarity). Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space (By similarity). The ddp-1/tim-8-tim-13 complex mediates the import of some proteins while the predominant tim-9/tin-9.1-tim-10/tin-10 70 kDa complex mediates the import of much more proteins (PubMed:15485840).

Belongs to the small Tim family.

9.578 kDa

MDSADPQLNRFLQQLQAETQRQKFTEQVHTLTGRCWDVCFADYRPPSKMDGKTQTCIQNCVNRMIDASNFMVEHLSKMNGGHV