dadD

5'-deoxyadenosine deaminase

449 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

49.429 kDa

MADPKDISPCKNEDLFLKCRSTLITGVLLPDKTRSDIWYDETGTIRTCGPDIARNHRNEADIILDGSGFLAMPGLINTHTHAAMTLLRGYADDMHLQQWLSEKIWPLEAHLTGEHVYWGTKLACLEMIRSGTIAFNDMYFYMKDAARAVQESGIRAVLSHGIITFGDEAKMEAELKATEDLVHHVRSLNTSLITSAIAPHAPYTVPPQHLEVCADYSQKEKIIIHTHLAETKQEVDDCQKSYGMTPAALLDKTGCLTERTVAAHGCWLSEDDCRLLAERRVSVAHNPVSNMKLATGRAMPYHWLKDQGVNVCLGTDGCSSNNNLDMLEEMKTAALCQKFFWNSDTLLPAAEALSMGTSWGAKALGYQGGVIQEGMPADIVLISLSHPSMVPLHNPVSNIAYSAEGSVVDTVICQGKILMYNRYIPDEEKIIAGARESADDLLNRAGIMA

dadD

5'-deoxyadenosine deaminase

442 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

47.461 kDa

MTTQESADIFGNNKSILITNVNDGTGPVDIFIDAEETISDIGCEIRKRHRGEAEFIVDGAGALALPGLSNTHTHAAMSLLRGYADDMILQDWLAQKIWPLEAHLTADDVYWGTRLACLEMIRTGTTAFNDMYFFMESAAKAVDEAGIRALLCYGFIDLGDAEKRERECRATEALVAHIRGLKNSRIHAAAGPHAPYTVSPEGLKWCGEFSREQDIPVHIHLSETEKEVNDCVARHKKRPAALLDECGLLSPRTIAAHGCWLDDAECALLGKRGVSVSHNPASNMKLATHRALPYRELVAAGANVCLGTDGCASNNNLDLFEEMKIAALLQKFFWNDPTVLAAPEALGMATANGAKALGFGDGALVAGAPADLILVTTRTPANTPLHNAASNLVYACSGSAVETTICNGRVLMFDREIPGEEKVLAEAAGAAARLVRRAQTPS

dadD

5'-deoxyadenosine deaminase

435 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

48.014 kDa

MTDNTILIKDALILNPLDFKEIKGSLLIKNDKIAEIGTDIDESNVDKVIDAKGKILLPGFVNTHTHLSMTLFRGLADDLSLDSWLNDNIWPMEANLTSEYCYIGALLGAIELIKSGTTTFSDMYFYMEDVAKAVEESGIRAVLSYGMIDFGDDEKREHEIKENIALFEKCNGMADGRIKVFFGPHSPYTASKDLLEDVRWLANEYNTGIHIHVSETQKEINDSLEAHDLRPFEYLDSIGFLGPDVVAAHSVWLSHNEIEIIKRNNVKISHNPCSNMKLASGIAPIQDLITNDICVGIGTDGASSNNNLDLIEELRTASLLQKVNLLNPKALTSNEALAMGTIKGAEVLGLEQEIGSIEVGKKADLILIDTNNANMVPDSSATSSNIIYSANGYNVDTTICDGKILMENRKLTTLDEEEIYKKARKAIEELKEASK

dadD

5'-deoxyadenosine deaminase

434 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

47.118 kDa

MADIIIKNGYVLTMDPEVDDIPNGVVVIEGGKIVEVAETTSATANTVIDAQGGVVMPGFVNTHTHAGMTLFRGYADDLPLAQWLQEHIWPAEAELTASDVLAGTRLACLEMIKSGTIAFADMYFFMEEVGKAVEECGLRAALSYGMIELWDDEKGTNELKKGREFVKEWNGKAEGRISVMYGPHAPNTCSKEFLSKVKEQAIADNVKIHIHVLETEAELNQMKEQYGMCSVNMLDTIDFFGPGVLAAHCIWLSDGDMDILADNNVNIAHNPVSNMKLASGVAPVMKLLDKGANVCLGTDGCASNNNLDMFDEMKTAALLQKVDTMDPTALPAKQVLEMATVNGAKALDINSGVLRKDYNADVIIIDMNKAHLSPLFDVPSQLVYSATGNDVRTTIVNGVVLMDERKVLCMNEQQVINDAKQAASDLVSRVDAKN

dadD

5'-deoxyadenosine deaminase

432 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

47.085 kDa

MADIIIKNAYVLTMDPDAGDIKKGTVVIEDGKITEIGVKTKESADTVIDAKGSVVMPGLVNTHTHAAMTLFRGYADDLQLAEWLEKHIWPAEAQLTAEDVYRGSLLACLEMIRSGTTSFADMYFFMDETAKAVEASGLRASLSHGLIELWNEEKGENDLKEGKRFVRAWQGAAKGRIKTMYGPHAPNTCSDEFLAKVKEAARQDGAGLHIHVLETEAELLAMKERYGKCSVHMLDDIGFFGPDVLAAHCVWLSDGDIEVLREKGVNVSHNPISNMKLASGTAPVYKMLERGVNVSLGTDGCASNNNLDLFEEMKTAALLHKLSTCNPTALPARQVLQMATVNGAKALGTETGMLKTGMKADMIIVDMKKPHLTPCFDVPSHLVYSAGGSDVRTTIVDGKILMQDYRVMVLDEQKVIEEAQKAAEELVARVNS

dadD

5'-deoxyadenosine deaminase

432 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

47.157 kDa

MADIIIKNAYVLTMDPDAGDLKNGTVVIEDGKITEIGENTKENADTVIDAKGSVVMPGLANTHTHAAMTLFRGYADDLQLAEWLEKHIWPAEAQLKAEDVYKGSLLACLEMIKSGTTSFADMYFYMDETAKAVEASGLRASLSHGLIELWNEEKGEADLKEGKRFVRAWQGAADGRIKTMYGPHAPNTCSEEFLTKVKEEAHRDGAGLHIHVLETEAELNAMKERYGKCSVHLLEDIGFFGPDVLAAHCVWLSDGDIEILRQREVNVSHNPISNMKLASGIAPVYKMLEKGVNVTLGTDGCASNNNLDLFEEIKTAALLHKVSTGNPTALPARQVLEMATVNGAKALGTETGMLKVGKKADMIVVDMKKPHLTPCFDVPSHLVYSAKGCDVRTTIVDGKVLMDNYRVLVMDEEKVIEEARTAAEELVARANA

dadD

5'-deoxyadenosine deaminase

432 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.97 kDa

MADIIVKNAYVMTMDPDEGDLKNGTVVIEDGKITEIGEKTSESADTVIDAKHSVVMPGLVNTHTHAAMTLFRGYADDLQLADWLEGHIWPAEAKLTAEDVYKGSLLACLEMIRSGTTSFADMYFYMDETAKAVEASGLRASLCHGLIELWNEEKGATDLKEGKRFVRAWQGAADGRIKTMYGPHAPNTCSEEFLAKVREEANRDGAGIHIHLLETEAELLAMKERYGKCSVHLLEDIGFLGPDVLAAHCVWLSDGDIEILGKRGVNVSHNVISNMKLASGIAPVYKMLEKGVNVSLGTDGCASNNNLDLFEEMKTAALLHKVNTFSPTALPARQVLQMGTVNGAKALGTETGMLKVGMKADLIVVDMKKAHLTPCFDVPSHLVYSAKGSDVRTTIVNGKVLMDDYKVLALDEQKVMEDAQKAAEELVTRVNA

dadD

5'-deoxyadenosine deaminase

431 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

47.752 kDa

MRLAILGGIAVTPERVIEDAGILIDEDGRISFVDTREQLEECEDWEDEIELGEKDVIMPGLINTHTHGPMTLFRGVADDMPLMKWLREEIWPLEERLDAEKCRWGAALAAMEALKSGTTCLADMYFFMDAVAEAYAEVGIRAVISHGMIDLGEEDKREEELKESKRVYRKCQGMEGLIEFSLGPHAPYTCSEELLKEVRRLADEWGVKIQIHVAETEDEVKEVKRKHGKRPVEYLDEIGLLGDDVIAAHCVWLDDKEIEILSKRGVIVSHNPISNMKLASGISPVPEMLERGVNVTIGTDGCASNNNLDMLEEIKVAALLHKVNKMDPSATEMLEILRMATVRAGTVFSSEKIGAIEEGYAADLVVLDGSSPRLNPNHNPISNIVYSASGSDVKHVFVAGELVVKNGKLVKADEQEILENSTECAEQLTSS

dadD

5'-deoxyadenosine deaminase

428 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

48.095 kDa

MILIQDATINNKVQDILIEKNKIKKIGKNLIQKENLNRKDLKIIDGKNKIIIPGLVNTHTHTPMTLFRGVADDLPLMDWLNNYIWKMEANLNEKIVYDATMLGCMEMIKSGTTTFNDMYFYMNGIIKGVQETGIRAYLGYGMIDLFDEEKRENELKETVNTVENIQKLNNPKINPTVSPHAPYTCSMELLQESHNLAKKYNVPLHIHLNETIDEIKTVEEMTNKRPFEYLDSFGFFNGVKVISAHNVHLSNKEIEIIKNKNIAISHNPISNLKLASGIAPIPKLMENTVLITLGTDGCGSNNNLNLFEEIKMASLIHKGNSLNPTVVSASQSFEFATKNGANALGLNAGELVEGALADVVIIDINKPYLIPNENIYSHLVYSFNGVVDMVIIDGEIVLNNGKMVNINEEKVYENAEKSYNKLLNNSDE

dadD

5'-deoxyadenosine deaminase

427 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.442 kDa

MDNESILITGPEILDAGGIRRGSVLIEDNRIADVSNTLSPGDADTVIDGTGKLLIPGLVNTHTHLSMTLFRGIADDLPLDRWLNDHIWPAEARLNGDYCYAGALLGCIEMIRSGTTSFNDMYFYMDHVARAVEEAGLRCVISHGMIDLGDTEKMTAELRESRRIIKECHGMADDRIRVALGPHSPYTCSEELLKETAALADKNDLMIHIHVSETENEVSEVSRSHGMTPVEYLDEVGVLGPRTVAAHCVWLKDWEIDVLAERDVKVSHNPSSNMKLASGVSPVARLLQRGVNVSLGTDGAASNNNLDMFQEMKTASLLQKVNLEDPTALPAMDVFSMATLNGARALGIDAGLIAPGKLADIVILNTRRPHLTPWRNPPSHTVYSASGADVDTVICDGRILLRDGELEVLEEKYVMELAEAAAAELTG

dadD

5'-deoxyadenosine deaminase

425 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.881 kDa

MSETTSILIKDTTILSDKIKKASILIVDNTIEEISNDLSVTDASKVIDGTNKITMPGLVNTHSHVAMTLLRGVGDDEELQTWLNDYIWPKEAKLDEKLVYAGSKLAMAEMIKTGTTTFNDMYFYMEETAKAVEESGIRGVLGYGMIDLFDDEKRKQEIKATKNLIKNSHNTANGRVQVAVAPHAPYTCSKELLSESKKLANKHNLKLHIHVSETQQEVNDLEKQRNQTPFEYLDSIDLLDENTIAAHGVWTTDNEMKLLKEKQVSISHNPSSNMKLASGIAPVSKYIKNDINVAIGTDGVSSNNNLDMFSEMKLTALLQKVNTMNAKTLPAQATFNMATENGARALGINTGSIKEGKLADIVLVNMNVPHMIPVRNPLSNIIYSALGSDVDTVICDGQLLLEDKKLLTINEEDAIYDAKLAAQQL

dadD

5'-deoxyadenosine deaminase

422 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.811 kDa

MILVKDAIINGKKQNMLVEGNIIKKIGNISNSEVSKDETEIIDGKNCVLIPGLINTHTHVPMSLFRGVADDIPLMDWLSGHIWPMESKLNEKIVYAGTLLGTIEMIKSGTTAFNDMYFFLDSIIKAVDETGIRSTIAYGMIDLFDEEKREKELKTARESLEMIKNLNNSRITGALGPHAPYTCSKEILESTNALAREFNVPIHIHMNETLDEINQVVERTGMRPFEYLNSFGFFEDVTTICAHCVHLSDSEIQIMKEKNMFAAHNPVSNLKLASGVSPVLKLLENNIPVTLGTDGCGSNNNMNLFEEIKAVALIHKGVNLNPVAVTAKEAFEFGTKNGAKALNINSGEIKEGKLADFVLINMKKPYLTPKENIESHLVYSFNGVVDTVVIDGKIVLNAGKMVNIDEEKVYELAEEAYFELAK

dadD

5'-deoxyadenosine deaminase

422 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.688 kDa

MILVKDANINGKKQDLLVEGNIIKKIGNISISEVSKDETEIIDGKNCVLIPGLVNTHTHVPMSLFRGVADDIPLMEWLSGHIWPMESKLNEKIVYAGTLLGTIEMIKSGTTAFNDMYFFLDSIIKAVDETGIRSTIAYGMIDLFDEEKREKELKTAKESLEMIKNLNNSRITGALGPHAPYTCSKEILDSTNALAREYNVPIHIHMNETLDEINQVVEKTGIRPFEYLNSFGFFDNVNTICAHCVHLSDSEIQIMKEKNIFVAHNPVSNLKLASGVSPVLKLLENNISVTLGTDGCGSNNNMNLFEEIKAAALIHKGVNLNPVAVTAKEAFEFGTKNGAKALNINSGEIKEGKLADFVLINMKKPYLTPKENIESHLVYSFNGVVDTVVIDGKIVLNDGKMVNIDEEKVYELAEEAYLELAN

dadD

5'-deoxyadenosine deaminase

422 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.73 kDa

MILVKDAIINGKKQDLLVEGNIIKKIGNISISEVSKDETEIIDGKNCVLIPGLVNTHTHVPMSLFRGVADDIPLMEWLSGHIWPMESKLNEKIVYAGTLLGTVEMIKSGTTAFNDMYFFLDSIIKAVDETGIRSTIAYGMIDLFDEEKREKELKTARKSLETIKNLNNSRITGALGPHAPYTCSKELLESTNTLAREYNVPIHIHMNETLDEINQVVEKTGMRPFEYLNSFGFFNDVNTICAHCVHLSDSEIQIMKEKNIFAAHNPVSNLKLASGVSPVLKLLENNVPVTLGTDGCGSNNNMNLFEEIKAAALIHKGVNLNPVAVTAKEAFEFATLNGAKALNINSGEIKEGKLADFVIINMKKPYLTPKENIESHLVYSFNGVVDTVVIDGKIVLNDGKMVTIDEEKVYELAEEAYLELTK

dadD

5'-deoxyadenosine deaminase

422 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.703 kDa

MILVKDAIITGKKQDLLVEGNIIKKIGNISISEVSKDETEIIDGKNCVLIPGLINTHTHVPMSLFRGVADDIPLMEWLSGHIWPMESKLNEKIVYAGTLLGTIEMIKSGTTAFNDMYFFLDSIIKAVDETGIRSTIAYGMIDLFDEEKREKELKTAKESLEMIKNLNNSRITGALGPHAPYTCSKEILESTNALAREYNVPIHIHMNETLDEINQVVEKTGMRPFEYLNSFGFFDNVNTICAHCVHLSASEIQIMKEKNIFAAHNPVSNLKLASGVSPVLKLLENNIPVTLGTDGCGSNNNMNLFEEIKAAALIHKGVNLNPVAVIAKDAFDFGTKNGAKALNINSGEIKEGKLADFVLINMKKPYLTPKENIESHLVYSFNGVVDKVVIDGKLVLNDGKMVNIDEEKVYEIAEEAYFELAN

dadD

5'-deoxyadenosine deaminase

422 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.767 kDa

MILVKDAIINGKKQDLLVEGNIIKKIGNVPISEVSKDETEIIDGKNCILIPGLVNTHTHIPMSLFRGVADDIPLMEWLSGHIWPMESKLNEKIVYAGTLLGAVEMIKSGTTAFNDMYFFLDSIIKAVDETGIRSTIAYGMIDLFNEEKREKELKSAKKSIEMIKKLNNSRITGALGPHAPYTCSKELLESTNALAREYNVPIHIHMNETVDEINQVLEKTKMRPFEYLNSFGFFDNVTTVCAHCVHLNDSEIKIIKEKNIFVAHNPISNLKLASGVSPVAKLLENEVNITLGTDGCGSNNSLNLFEEMKTAALIHKGVNLNPVLVTAKEAFEFGTLNGAKALNINSGEIKEGKLADFALINVKKPYLTPRENIESHLVYSFNGAVDSVVIDGKLTLKDGKMVTIDEEKVYELAEEAYLELTK

dadD

5'-deoxyadenosine deaminase

420 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated (PubMed:24375099). Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions (PubMed:25917907). May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens (PubMed:24375099).

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

47.468 kDa

MILIKNVFVNGKRQDILIEGNKIKKIGEVKKEEIENAEIIDGKNKIAIPGLINTHTHIPMTLFRGVADDLPLMEWLNNYIWPMEAKLNEEIVYWGTLLGCIEMIRSGTTTFNDMYFFLEGIAKAVDESGMRAVLAYGMIDLFDEERRERELKNAEKYINYINSLNNSRIMPALGPHAPYTCSKELLMEVNNLAKKYNVPIHIHLNETLDEIKMVKEKTGMEPFIYLNSFGFFDDVRAIAAHCVHLTDEEIKIMKQKNINVSHNPISNLKLASGVAPIPKLLAEGINVTLGTDGCGSNNNLNLFEEIKVSAILHKGVNLNPTVVKAEEAFNFATKNGAKALNIKAGEIREGYLADIVLINLDKPYLYPKENIMSHLVYAFNGFVDDVIIDGNIVMRDGEILTVDEEKVYEKAEEMYEILRS

dadD

5'-deoxyadenosine deaminase

413 amino acids

Catalyzes the deamination of three SAM-derived enzymatic products, namely 5'-deoxyadenosine, S-adenosyl-L-homocysteine, and 5'-methylthioadenosine, to produce the inosine analogs. Can also deaminate adenosine. The preferred substrate for this enzyme is 5'-deoxyadenosine, but all these substrates are efficiently deaminated. Likely functions in a S-adenosyl-L-methionine (SAM) recycling pathway from S-adenosyl-L-homocysteine (SAH) produced from SAM-dependent methylation reactions. May also be involved in the recycling of 5'-deoxyadenosine, whereupon the 5'-deoxyribose moiety of 5'-deoxyinosine is further metabolized to deoxyhexoses used for the biosynthesis of aromatic amino acids in methanogens.

Belongs to the metallo-dependent hydrolases superfamily. MTA/SAH deaminase family.

46.382 kDa

MLIRSASIIRNGSLLKNIDILIEGNRISEVGRDLRPNDDEIIDARNMLAVPGLVNSHTHLAMTLLRGYADDMELIPWLQEKIWPLEARLKPSDVRAGVKLGCLELIRFGVTCYNDMYYFMDETAAATREMGIRGVLSGVLFDMRPEFINDVEPFIKKWRDDDLIKPAVGPHAVYTCSEETLLRAKDIAERYDVKIHIHLSETRDEVDTFVNQRHMSPVEYLENLGFLSERVVAAHCVWLTPRDIRILAERHVNVAHCPISNLKLASGIAPVATLIEHGVNVCLGTDGASSNNNLDIFEEMKVAAVVQKCSVGRSAILPADAVWRMATENAYKAFSLDMGIRRGALADLALINMRRPWFIPVTSMISHLVYSMSGEASYTICNGRVLMRDGVIEGEAKILDEAQRCYERLISEE