cytC

Cytochrome c

113 amino acids

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain (By similarity).

Belongs to the cytochrome c family.

12.715 kDa

MSDIIARGNVENGDKLFKARCAQCHTTANGAPNKQGPNLYGLFFPKSRSFPGYAYSDPNKNTGKFCIMWGEQTLFDYLENPKKYIPKTKMAFAGFKSEQDRADVVAYLEQSTK

CYTC

Cytochrome c

113 amino acids

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

Belongs to the cytochrome c family.

12.323 kDa

MASFSEAPPGDFKSGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVNWDENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATSS

cytC

Cytochrome c

113 amino acids

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain (By similarity).

Belongs to the cytochrome c family.

12.715 kDa

MSDIIARGNVENGDKLFKARCAQCHTTANGAPNKQGPNLYGLFFPKSRSFPGYAYSDPNKNTGKFCIMWGEQTLFDYLENPKKYIPKTKMAFAGFKSEQDRADVVAYLEQSTK

CYTC

Cytochrome c

113 amino acids

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

Belongs to the cytochrome c family.

12.323 kDa

MASFSEAPPGDFKSGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAANKNKAVNWDENTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEATSS

cytC

Cytochrome c

108 amino acids

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.

Belongs to the cytochrome c family.

11.91 kDa

MGIPAGDPEKGKKIFVQKCAQCHTIESGGKHKVGPNLYGVYGRKTGQAPGYSYTDANKGKGITWNKETLFEYLENPKKYIPGTKMVFAGLKKPQERADLIAYIEQASK

CYTC

Cytochrome c

108 amino acids

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain (By similarity).

Belongs to the cytochrome c family.

11.984 kDa

MGFSAGDLKKGEKLFTTRCAQCHTLKEGEGNKVGPALHGLFGRKTGSVEGYAYTDANKQKGIEWTEDTLFTYLENPKKYIPGTKMAFGGLKKDKDRNDLISYLKKETA