cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

209 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

22.847 kDa

MSTAVLNKHLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDIFELPYVLVETAILLVSSCTYGLAMLSAHKGAKGQAIAWLGVTFLLGAAFIGMEINEFHHLIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSLFWHFLDIVWICVFTVVYLMGAL

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

207 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

22.814 kDa

MSSQVMHGAAHGHDHGHDDHHHDSGQMTVLGFWLYLMTDCILFASLFATYAVLSGSFAGGPSGHDIFQLDFVAVETLFLLLSSITFGFAMLKMFDGKKAGVLGWLAVTFLFGAGFIAMEIYEFHHLIAEGFGPQRSGFLSGFFALVGTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRMSCLSLFWHFLDVVWICVFTVVYLLGVL

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

205 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

23.639 kDa

MIENKFNNTILNSNSSTHDKISETKKLFGLWIYLMSDCIMFAVLFAVYAIVSSNISINLISNKIFNLSSILLETFLLLLSSLSCGFVVIAMNQKRIKMIYSFLTITFIFGLIFLLMEVHEFYELIIENFGPDKNAFFSIFFTLVATHGVHIFFGLILILSILYQIKKLGLTNSIRTRILCFSVFWHFLDIIWICVFTFVYLNGAI

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

205 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

23.639 kDa

MIENKFNNTILNSNSSTHDKISETKKLFGLWIYLMSDCIMFAVLFAVYAIVSSNISINLISNKIFNLSSILLETFLLLLSSLSCGFVVIAMNQKRIKMIYSFLTITFIFGLIFLLMEVHEFYELIIENFGPDKNAFFSIFFTLVATHGVHIFFGLILILSILYQIKKLGLTNSIRTRILCFSVFWHFLDIIWICVFTFVYLNGAI

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

204 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

22.623 kDa

MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

204 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron.

Belongs to the cytochrome c oxidase subunit 3 family.

22.623 kDa

MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

204 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

22.623 kDa

MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

194 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

22.941 kDa

MKKKYKIDTNIFSKELLGFWLYLMSDCIIFCTLFSVYFILVDNVAQGPSGHNIFQNNLIIIETFLLLFSSFSCNLVLFEMKNKNLYMVFLWLGITFLLGLLFVFLELFEFFHLINLGFGPTRSGFLSSFFVLIATHGIHVISGLIWIIVMIKYVYTFNITNLIYYRMLCLNLFWHFLDIVWVFIFSFVYLFGMV

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

189 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

22.163 kDa

MIKETMRNNKLFGLWIYLMSDCIIFAVLFAVYAIISSNFSTNLINHKIFNLSYVFLETLILLLSSLSSGMLTIQKNKNNIKIIYFYLLLTFFLGLSFLLMEVNEFYKLILENCSPSQHAFFSIFFTIVGVHGIHVFFGLIFILSILYQLFYLGITNTIRIRILCFSLFWHFLDIIWICVFTFVYLNGVI

cyoC

Cytochrome bo(3) ubiquinol oxidase subunit 3

189 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 3 family.

22.163 kDa

MIKETMRNNKLFGLWIYLMSDCIIFAVLFAVYAIISSNFSTNLINHKIFNLSYVFLETLILLLSSLSSGMLTIQKNKNNIKIIYFYLLLTFFLGLSFLLMEVNEFYKLILENCSPSQHAFFSIFFTIVGVHGIHVFFGLIFILSILYQLFYLGITNTIRIRILCFSLFWHFLDIIWICVFTFVYLNGVI