cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

331 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

36.623 kDa

MTKANPFAALKWLSLAPALLLGGCDMTLFNPKGQVGMDERTLIITATLLMLIVVIPVIVMTLAFAWKYRASNTQAEYKPDWHHSNRIEAVVWLVPCVIIAILGWITWESTHKLDPYRPLDSEVKPVTIQAVSLDWKWLFIYPEQGIATVNEIAFPKDTPVNFQITSDSVMNSFFIPQLGSQIYSMAGMMTKLHLIANEEGVFDGISANYSGGGFSGMRFKAIATSEQGFQDWVAKVKAAPASLSIGTYPELVKPSENVPPTYFSSVSPELFGHILTKYEHHGDAKGAAHGEHAGAEHEAAMTGHDMQDMDMQAMQGMKDMKDMHMQPSTQE

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

331 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

36.623 kDa

MTKANPFAALKWLSLAPALLLGGCDMTLFNPKGQVGMDERTLIITATLLMLIVVIPVIVMTLAFAWKYRASNTQAEYKPDWHHSNRIEAVVWLVPCVIIAILGWITWESTHKLDPYRPLDSEVKPVTIQAVSLDWKWLFIYPEQGIATVNEIAFPKDTPVNFQITSDSVMNSFFIPQLGSQIYSMAGMMTKLHLIANEEGVFDGISANYSGGGFSGMRFKAIATSEQGFQDWVAKVKAAPASLSIGTYPELVKPSENVPPTYFSSVSPELFGHILTKYEHHGDAKGAAHGEHAGAEHEAAMTGHDMQDMDMQAMQGMKDMKDMHMQPSTQE

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

315 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

34.911 kDa

MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFMAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

315 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron.

Belongs to the cytochrome c oxidase subunit 2 family.

34.911 kDa

MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFMAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

315 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

34.911 kDa

MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFMAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

315 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron.

Belongs to the cytochrome c oxidase subunit 2 family.

34.911 kDa

MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLILTAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLAVLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYFKVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKAIATPDRAAFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKFMAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

314 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

34.702 kDa

MSKKRYPRLFGILPFLGMLLLSGCNWTLLDPKGQVGIEQKNLILIATGLMLLVVIPVIIMTVVFAWKYRASNKAATYTPDWSHSTKIEAAVWIIPILIIIALGYFTYHSTHKLDPYRPLDSDVKPVQIDVVALDWKWLFIYPEQGIATVNKIVFPANTPVNFRVTSDAVMNSFFIPGLGGQIYAMAGMTTKLHLIANENGEFDGISANYSGAGFTGMKFKATATSQEDFDKWVAEVKQSPKKLDKAEYEALAKPSENNPVALYSEASPDQFQLIVDKYEGMNRGRPSHEEAGSKDLATTKGVESSMQPAAGAEE

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

314 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

34.702 kDa

MSKKRYPRLFGILPFLGMLLLSGCNWTLLDPKGQVGIEQKNLILIATGLMLLVVIPVIIMTVVFAWKYRASNKAATYTPDWSHSTKIEAAVWIIPILIIIALGYFTYHSTHKLDPYRPLDSDVKPVQIDVVALDWKWLFIYPEQGIATVNKIVFPANTPVNFRVTSDAVMNSFFIPGLGGQIYAMAGMTTKLHLIANENGEFDGISANYSGAGFTGMKFKATATSQEDFDKWVAEVKQSPKKLDKAEYEALAKPSENNPVALYSEASPDQFQLIVDKYEGMNRGRPSHEEAGSKDLATTKGVESSMQPAAGAEE

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

296 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

34.18 kDa

MKTLSLILIFFFLNGCNNPLLNSHGTIATEEYSLILISFIMMLFIIIPVIFMTIYFSLKYRSTNVNQIYKPNWCDSKKIEIVVWTIPIIIVSFLAFLSWSYTHKLDPKKSIVSLNNPIKIDAVALDWKWLFIYPDYNIATINEIMFPVNRPIVFRITSNSVMNAFFIPSLGSQIYAMPGMTTKLNLIANDVGKYKGISSNYSGHGFSNMKFTAISVLKNSTFLDWVKKVQASSIKLNTMKTFDIISIPNENYSIEYFSSVKKNLFNKIKNQYSIKHFILDENLSHEIVKKNFNMEK

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

296 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

34.18 kDa

MKTLSLILIFFFLNGCNNPLLNSHGTIATEEYSLILISFIMMLFIIIPVIFMTIYFSLKYRSTNVNQIYKPNWCDSKKIEIVVWTIPIIIVSFLAFLSWSYTHKLDPKKSIVSLNNPIKIDAVALDWKWLFIYPDYNIATINEIMFPVNRPIVFRITSNSVMNAFFIPSLGSQIYAMPGMTTKLNLIANDVGKYKGISSNYSGHGFSNMKFTAISVLKNSTFLDWVKKVQASSIKLNTMKTFDIISIPNENYSIEYFSSVKKNLFNKIKNQYSIKHFILDENLSHEIVKKNFNMEK

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

290 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

33.73 kDa

MISINFNNFFKTLLLILIAFTLHGCDSILFNPHGIIAIQECSILLISFLIMLFVIIPVIFMTIYFSVKYRASNINAKYKPDWCDSKKIEIIVWTIPISIILFLAFVTWNYSHILDPKKSIISKYKPIKIDVVSLDWRWLFIYPEYHIATINEIMFPINRSIIFHITSNSVMNSFFIPSLGSQIYAMPGMMTTLNLMSNSPGKYKGISSNYSGKGFSNMKFTAISVLNIKDFENWIKKAQQSPKKLNKMSIFNIISLPNENHFIEYFSDVKKNLFYEIINQTYSKNKVFKH

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

290 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

33.73 kDa

MISINFNNFFKTLLLILIAFTLHGCDSILFNPHGIIAIQECSILLISFLIMLFVIIPVIFMTIYFSVKYRASNINAKYKPDWCDSKKIEIIVWTIPISIILFLAFVTWNYSHILDPKKSIISKYKPIKIDVVSLDWRWLFIYPEYHIATINEIMFPINRSIIFHITSNSVMNSFFIPSLGSQIYAMPGMMTTLNLMSNSPGKYKGISSNYSGKGFSNMKFTAISVLNIKDFENWIKKAQQSPKKLNKMSIFNIISLPNENHFIEYFSDVKKNLFYEIINQTYSKNKVFKH

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

286 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

33.106 kDa

MQFIKYKSYILKFLLVSCIFCINGCDCTILCPNGLIAQEQRFVLFVSFFTMLLIIIPVIFMTIFFVLRYRESNFSKTYDPKWSHSNIIELLIWGIPIIIIVFLSIFSWKSVHDLDPKKPIVSNVQPIKINVISLDWKWLFIYPDQKIATINKLIIPINTPIIFNLTSGSVMNSFFIPSLGSQIYVMPGMKTNLNLIANKLGQFKGFSSNYSGKGFSNMKFDVLVTSDHIFFYEWVKKIQKSKYKLNSMYQFNQLAIPSDNNAIKYFSNLKENLFNVVIANVLKISL

cyoA

Cytochrome bo(3) ubiquinol oxidase subunit 2

286 amino acids

Cytochrome bo(3) ubiquinol terminal oxidase is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration. Has proton pump activity across the membrane in addition to electron transfer, pumping 2 protons/electron (By similarity).

Belongs to the cytochrome c oxidase subunit 2 family.

33.106 kDa

MQFIKYKSYILKFLLVSCIFCINGCDCTILCPNGLIAQEQRFVLFVSFFTMLLIIIPVIFMTIFFVLRYRESNFSKTYDPKWSHSNIIELLIWGIPIIIIVFLSIFSWKSVHDLDPKKPIVSNVQPIKINVISLDWKWLFIYPDQKIATINKLIIPINTPIIFNLTSGSVMNSFFIPSLGSQIYVMPGMKTNLNLIANKLGQFKGFSSNYSGKGFSNMKFDVLVTSDHIFFYEWVKKIQKSKYKLNSMYQFNQLAIPSDNNAIKYFSNLKENLFNVVIANVLKISL