About Services Proteins Contact

cyce3

Gene
cyce3
Protein
G1/S-specific cyclin-E3
Organism
Xenopus laevis
Length
408 amino acids
Function
Essential for the control of the cell cycle at the G1/S (start) transition.
Similarity
Belongs to the cyclin family. Cyclin E subfamily.
Mass
47.204 kDa
Sequence
MPVIRNPAAEKSTKDERTASCTVRSRKRKADVAIFLQDPDDTLDCLEMTKKKQYQDRGQLSNEMTCKSPHKLIPTPEKEEHEPNPTSYPHFASLRFSPVSASPLPRLGWANQDDVWRNMLNKDRIYLRDKNFFEKHPQLQPNMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRFMATQKNVIKSRLQLIGITSLFIAAKMEEIYPPKLHQFAFITDCACTEDEITSMELIIMKDLDWCLSPMTMVSWFNVFLQVAYIRELQHFLRPQFPQEVYIQIVQLLDLCVLDICCLDYPYGVLAASALYHFSCPELMEKVSGFKLTELQGCIKWLVPFAMAIKDGGKSKLKFFKGVDIEDVHNIQTHTGCLELMEKVHINRAVLEEQNRASPIPSGVLTPPQSDKKQKSDPAD