About Services Proteins Contact

ctnA

Gene
ctnA
Protein
Citrinin biosynthesis transcriptional activator mrl3
Organism
Monascus ruber
Length
509 amino acids
Function
Transcription factor that regulates the expression of the gene cluster that mediates the biosynthesis of the mycotoxin citrinin, a hepato-nephrotoxic compound to humans due to inhibition of respiration complex III (Ref.1).
Mass
57.541 kDa
Sequence
MASTAHRQPSRPTTRQRQRTGRACEECRRRKLRCDGQQPRCGVCVDSGVTCEVNSQRRPRGPKKGYLTALRNRVAMLETRLPAQHLVGPLSEFNPLSTPLTNDHHDGCSVSSASSRSDSNPPPTVSEPDMSLPNTTTSVSSAPSFATCSKDIGGAEPITELVQAELNQLYFDRVHPSIQILHQRRYLGWARNAAKKTSRRCLQYAVWTLASLLSAQFQHLQDSFYQETKRTLEFSYLSGDSNAPVDTEEIQAWILIATYESMRTFHRSAWMSAGRAFRLVQLMRLHEIDSPTKPPVPEADLVETEEKRRVFWMAYFLDHLLSMRNNWPITLNEHVICTRLPAPDMEFQSGQPVLGAFLSEAIMDVMPQTTSPFNECVILATICGRSLFHAQQYSVRFVYGELAPNWTDQHQWLDNVLTNRLQILSQYYPSPTQICDPMLSFAHIMGQASVIHLYKGMASVVWAVDDGAWVVEYQRRALSAAQEIVKLAKGLTEFNFFKVCHTASLPCND

Gene
ctnA
Protein
Countin-1
Organism
Dictyostelium discoideum
Length
258 amino acids
Function
Cell-counting factor that limits the maximum size of the multicellular structure. May down-regulate the expression of gp24, which mediates cell adhesion.
Similarity
Belongs to the countin family.
Mass
26.659 kDa
Sequence
MNKLFSLILALFLVNSAVVSSLDSCSICVDFVGNSLNDLLNIILNSGVIGTCGDLCSAVPGGQIVDTVCDLLCDYVGVDEFIKLISDVDPDPIYICEKISVCKTNDNAAASLDLVQINPQNGTVGGTFTLSIAYTVTNTIATGQLAFNIIDPTGNAFGDAVLLVQQSPEQYTQQFQFQATPSEQESFPNGLYTVQALVCEGSCGSPHPNTYTLANGTTTFTISGADSSSMSGAGSFSGSSQSTQTGAASGSGSGFALF