About Services Proteins Contact

ctbs1

Gene
ctbs1
Protein
Probable di-N-acetylchitobiase 1
Organism
Dictyostelium discoideum
Length
373 amino acids
Function
Involved in the degradation of asparagine-linked glycoproteins. May hydrolyze of N-acetyl-beta-D-glucosamine (1-4)N-acetylglucosamine chitobiose core from the reducing end of the bond.
Similarity
Belongs to the glycosyl hydrolase 18 family.
Mass
42.433 kDa
Sequence
MKIFIIISLILTILIIQSKSKECPCSNVELCKPLEIGPRKEFIGFSVNSTFYPYYNWDHLTTIGIFYSEDIEDELLCMAKTNGVRLVYSAFYPVEQLSNETYIDQWINEKLELVQNTFTDGLNFDVEYPITDPIVAQQYTQLVAATNNAFKSVNLYYQISVDVAWDASNCIDYRCYDYLGLSKASDFLVVMDYDMKLDGYYFKTCLASANSPPSSVLSGMVNFTKLGIDESSLVMGLPWYGYNYPCIGSNYTLQTFECIIPPSSYLGYNCTDASGIEINYSIIMNMLNDTAIQNGGVQWDSESESPYFNFIDLFSGTQHQMWFDNPDSLTIKVNIARTMNLRGVGVWNIDQLWDDHSLSSGMWGALNSFFKIN